KEGG   Aeropyrum camini: ACAM_1318Help
Entry
ACAM_1318         CDS       T02858                                 

Definition
ATP-dependent 6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
acj  Aeropyrum camini
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:acj00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ACAM_1318
Enzymes [BR:acj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ACAM_1318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1267774..1268715
Genome map
AA seq 313 aa AA seqDB search
MVLPGPGVQTHIAVGNINLDISLSVDRLPGPEEVVFARDAWIGVGGAATNYAIAVAFLGQ
KPVLVAVAGREMERLGVVDMLKSRGVDVSRVRTVDRPSGVVVVMVVASDSHRSMVSMRGA
NEELLKYIEEEPLEGAGGECHVHMASVPPQALDYAPRGCTLSYDPGGEAFKRPKSLWNRL
QRVDWMFINTSELRGMSGNGDLEAASRLLESGLRRLVLKHGRGGATVIERGLCLTLDRTP
VLEPIDVTGAGDAFDAAFNIAVKAGWGIGGALRLAVAAGSAKVLKRGSSNMPTAAEVLAM
LPRVASPRECSLG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggttctacccgggcctggcgtgcagacgcacatagcggtaggcaacatcaacctggac
attagcctctccgtcgacaggcttccagggccagaggaggttgtgttcgcccgtgacgcg
tggataggcgtgggcggggcggccactaactatgccatagcggtcgcctttctaggccaa
aagcccgttctggttgctgttgctggcagggagatggagaggctcggcgtggtggacatg
ctgaagagccggggggtggatgtatcgagggttaggacagttgacaggccctccggcgtt
gtcgttgttatggttgtggctagcgactctcacaggagcatggtgtcgatgaggggtgcc
aacgaggagctgctcaaatatatcgaggaggagcctcttgagggggcggggggcgagtgc
catgtgcatatggccagcgtgcccccccaggctctcgactacgcaccaagagggtgcacc
ctaagctacgacccaggcggtgaggctttcaagaggccgaagagcctgtggaacagactc
cagagggtggactggatgttcataaacacctcggagctgagggggatgagcggtaacggc
gacctggaggctgctagcaggctcctggaatctgggctgaggaggctggtgctgaagcac
ggtagaggcggtgccactgtaatcgagagaggcctctgccttacgctagacaggacgccg
gtgctagagccgatcgatgtgaccggggctggagacgccttcgacgcagccttcaatatc
gctgtaaaggctggatggggtattgggggggcgcttaggctggctgtggctgcaggatct
gctaaggtgcttaagagaggtagcagtaacatgcctacggctgcagaggtcctggctatg
cttcccagggttgcctctcctcgggagtgcagcctaggctag

DBGET integrated database retrieval system