KEGG   Acidovorax sp. KKS102: C380_00430Help
Entry
C380_00430        CDS       T02290                                 

Definition
glutathione S-transferase domain-containing protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
ack  Acidovorax sp. KKS102
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ack00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(92819..93427)
Genome map
AA seq 202 aa AA seqDB search
MKLYYSPGACSLSPHIALQEAGLAYTPVLASTKSHKLQDGTDYYTINALGYVPVLELDNG
ERLREGPAIVQYIADQVPDKQLAPANGTLARYRLQEWLTFIGTELHKGFSPLFNPATPEE
YKPMVRERLLQRLQWVDSQLAGKQYLMGDQFTVADGYLFTVTNWTQPTKLDISGLANLAA
YRERVGARPAVQAAMKAEGLLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttactactcccccggcgcctgctccctgtccccccacatcgccctgcaagag
gccggcctggcctacacccccgtgctggccagcaccaagagccacaagctgcaggacggc
accgactactacaccatcaatgcgctgggctacgtgcccgtgctggagctggacaacggc
gagcgcctgcgcgaaggcccggccatcgtgcaatacattgccgaccaggtgcccgacaaa
caactcgcccccgccaacggcaccctggcgcgctaccgcctgcaagagtggctgaccttc
atcggcaccgagctgcacaagggcttcagccccctgttcaaccccgccacccccgaggag
tacaagcccatggtgcgcgagcgcctgctgcagcgcctgcagtgggtggacagccagctc
gccggcaagcagtacctgatgggcgaccagttcaccgtggccgacggctacctgttcacc
gtgaccaactggacgcaacccaccaagctcgacatctccggcctggccaacctggcggcc
taccgcgaacgcgtgggtgcccgccccgcagtgcaggcggccatgaaggccgaaggcttg
ctgaaatag

DBGET integrated database retrieval system