KEGG   Acidovorax sp. KKS102: C380_03090Help
Entry
C380_03090        CDS       T02290                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ack  Acidovorax sp. KKS102
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:ack00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:ack00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
663944..664489
Genome map
AA seq 181 aa AA seqDB search
MQITRLSIPEVVLIEPRVFGDARGVFYESFNQRAFNEATETSYQFVQDNHSYSRKGVLRG
LHYQLQRPQGKLVRVVQGVVFDVAVDLRKSSPTFGKWVGQILSAEHRTLMWVPPGFAHGF
LTLSDTSDFIYKTTDYWCPEHERVIRWDDPTLGIEWPLVMSPILADKDAIAPPICSDDLY
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcacacgcttgtccattcctgaggtggtactgatcgaacccagggtgttcggc
gatgcgcgtggagttttctacgaaagcttcaaccagcgcgcgttcaatgaagctactgaa
accagttaccagtttgtccaggacaaccacagctacagccgcaaaggtgttttgcgcgga
ttgcactaccagctccagcgcccccagggcaagctggtgcgcgtcgtccagggtgttgtc
ttcgatgtcgcggtcgatctgcgcaaatcatctccgacgttcggaaaatgggtaggccaa
atcctgagcgctgaacatcggacgctgatgtgggtgccaccggggtttgcccacggattc
ctgacactgagtgacacatcggactttatttataagacaacagattattggtgcccagaa
catgagcgagttattcgttgggatgatcccactctgggaattgaatggccgcttgtgatg
tcgcctatattggcggataaagatgccattgcgcctccaatatgtagtgatgatttgtat
gagtga

DBGET integrated database retrieval system