KEGG   Acidovorax sp. KKS102: C380_03640Help
Entry
C380_03640        CDS       T02290                                 

Definition
glutathione S-transferase domain-containing protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
ack  Acidovorax sp. KKS102
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    C380_03640
Enzymes [BR:ack01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     C380_03640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(803077..803781)
Genome map
AA seq 234 aa AA seqDB search
MTDLSAFAITRKWPARHPDRIQLYSLPTPNGVKVSIALEELGLPYEPHLVSFETNDQTTP
EFLSLNPNNKIPAILDPNGPDGQPLALFESGAILVYLASKTGQLMPQDTAGRYETLQWVM
WQMGGVGPMFGQLGFFHKFAGKDYEDKRPRDRYVAESKRLLKVLDERLAGRPWVMGDQYT
IADIAILPWVRNLIGFYGAGDLVEFGQFKEVQRVLDAFVARPAVARGLAIPARG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctttccgcttttgccatcacccgcaaatggcccgcccggcacccggaccgc
atccagctgtattccctgcccacgcccaacggcgtgaaggtgtccatagcgctggaagaa
ctgggcctgccctacgagccccacctggtgagctttgagaccaacgaccagaccacgccc
gaattcctctcgctcaaccccaacaacaagatcccggccatcctggacccgaacgggccg
gacggccagccgctggcactgttcgagtccggcgccatcctggtgtacctagccagcaaa
accggtcagctgatgccgcaggacaccgccgggcgctacgaaaccctgcagtgggtgatg
tggcagatgggcggtgtgggccccatgtttggccagctggggttcttccacaagtttgca
ggcaaggactacgaagacaaacgcccgcgcgaccggtatgtcgctgagtcgaagcgcctg
ctcaaggtgctggacgagcgcctggcaggccgcccatgggtgatgggcgaccagtacacc
atcgccgacattgccatcctgccctgggtgcgcaacctcatcggcttctatggggcgggc
gacctggtggagtttggccagttcaaggaagtgcaacgcgtgctcgatgcgtttgtggcg
cgcccagcggtggcccgggggctggcgattccggcacgcggctga

DBGET integrated database retrieval system