KEGG   Acidovorax sp. KKS102: C380_03640Help
Entry
C380_03640        CDS       T02290                                 

Definition
(GenBank) glutathione S-transferase domain-containing protein
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
ack  Acidovorax sp. KKS102
Brite
Enzymes [BR:ack01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     C380_03640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(803077..803781)
Genome map
AA seq 234 aa AA seqDB search
MTDLSAFAITRKWPARHPDRIQLYSLPTPNGVKVSIALEELGLPYEPHLVSFETNDQTTP
EFLSLNPNNKIPAILDPNGPDGQPLALFESGAILVYLASKTGQLMPQDTAGRYETLQWVM
WQMGGVGPMFGQLGFFHKFAGKDYEDKRPRDRYVAESKRLLKVLDERLAGRPWVMGDQYT
IADIAILPWVRNLIGFYGAGDLVEFGQFKEVQRVLDAFVARPAVARGLAIPARG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctttccgcttttgccatcacccgcaaatggcccgcccggcacccggaccgc
atccagctgtattccctgcccacgcccaacggcgtgaaggtgtccatagcgctggaagaa
ctgggcctgccctacgagccccacctggtgagctttgagaccaacgaccagaccacgccc
gaattcctctcgctcaaccccaacaacaagatcccggccatcctggacccgaacgggccg
gacggccagccgctggcactgttcgagtccggcgccatcctggtgtacctagccagcaaa
accggtcagctgatgccgcaggacaccgccgggcgctacgaaaccctgcagtgggtgatg
tggcagatgggcggtgtgggccccatgtttggccagctggggttcttccacaagtttgca
ggcaaggactacgaagacaaacgcccgcgcgaccggtatgtcgctgagtcgaagcgcctg
ctcaaggtgctggacgagcgcctggcaggccgcccatgggtgatgggcgaccagtacacc
atcgccgacattgccatcctgccctgggtgcgcaacctcatcggcttctatggggcgggc
gacctggtggagtttggccagttcaaggaagtgcaacgcgtgctcgatgcgtttgtggcg
cgcccagcggtggcccgggggctggcgattccggcacgcggctga

DBGET integrated database retrieval system