KEGG   Acidovorax sp. KKS102: C380_04055Help
Entry
C380_04055        CDS       T02290                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ack  Acidovorax sp. KKS102
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    C380_04055
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C380_04055
   00052 Galactose metabolism
    C380_04055
   00500 Starch and sucrose metabolism
    C380_04055
   00520 Amino sugar and nucleotide sugar metabolism
    C380_04055
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    C380_04055
   00524 Butirosin and neomycin biosynthesis
    C380_04055
Enzymes [BR:ack01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     C380_04055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
899721..900698
Genome map
AA seq 325 aa AA seqDB search
MTPLRLLADIGGTNIRLAWQDQPDGPLHDTRVLPCAQFPTVDAALSAYLAEVNIATPREA
AFGIANPVTGDAIRMTNHSWSFSQRAVREAFGFERLVVINDFTALALALPLLTPEQLRPV
GGGEAVPGAAIALLGPGTGLGVSGLVFPPGSSLGVPLSGEGGHVTLAAQTQREFDVLGIL
QERYGHVSAERAVCGAGLVDLYHALRRLAQRGGKEVSSAAQVTELALQANDPLAQEALEL
FCGFLGSVAGNLALTLGARGGVFIGGGMVPRLGTWFDQSPFRARFESKGRFQSYLATIPC
WVIDPSATPALFGASRALDIAGSDA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgacacccctgcgcctgctggccgacatcggcggcaccaacattcgcctggcctggcaa
gaccagcccgatggccccctgcacgacacccgtgtgttgccctgtgctcagttccccacg
gtggatgctgccctgtcggcctacctggccgaagtgaacatcgccaccccgcgcgaggcg
gcgtttggcatcgccaacccggtcacgggagacgccatccgcatgaccaaccacagctgg
agcttctcgcagcgcgccgtgcgcgaggcgtttggttttgagcggctggtggttatcaac
gacttcaccgcactcgcgctggcgctgcccctgctcacgcccgagcagctgcgcccggtg
ggtggtggcgaggccgtgccgggcgccgcaattgcgttgctgggcccgggcacgggcctg
ggcgtgtcgggcctggtgtttccgcccggctcgagcctgggggtgccgctgtcgggcgag
ggcggccatgtcacgctggccgcgcagacccagcgcgagttcgatgtgctgggcatcctg
caagagcgctacggccacgtgtcggccgaacgcgccgtgtgtggcgccgggctggtggac
ctgtaccacgcgctgcggcggctggcccagcgcggtggcaaggaggtcagctcggccgcg
caggtgactgagctggcactgcaagccaacgacccgctggcgcaggaggcgctggagctg
ttctgcggcttcttgggcagcgtggcgggcaatcttgcgctcacgctcggcgcgcgcggc
ggcgtgttcatcggcggcggcatggtgccgcgcctgggcacgtggtttgaccagtcgccg
ttccgcgcacggtttgaatccaaggggcggttccagtcttacctggcgacgattccctgc
tgggtgattgaccccagcgccacacccgcgctgtttggcgcatcgcgtgcgctggacatt
gcgggctcggatgcatga

DBGET integrated database retrieval system