KEGG   Acidovorax sp. KKS102: C380_04385Help
Entry
C380_04385        CDS       T02290                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ack  Acidovorax sp. KKS102
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    C380_04385
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C380_04385
Enzymes [BR:ack01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     C380_04385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
973872..975146
Genome map
AA seq 424 aa AA seqDB search
MDKLLIRGGRSLQGDVLVSGAKNAALPELCAALLTAEPVTLLNVPQLQDVSTMLKLIRNM
GVAAERADDGTVRINASALSTPEAPYELVKTMRASVLALGPLLARFGEATVSLPGGCAIG
SRPVDQHIKGLAAMGAEIVVEHGYMIAKLPAGWKRLKGARITTDMVTVTGTENFLMAAAL
AEGETVLENAAQEPEISDLAEMLIAMGAKIEGHGTSRIRIQGVEKLHGCTHRVVADRIEA
GTFLCAVAATGGDVVLRHGRADHLDAVIEKLREAGATVQAVDGGIRVQSAGGATLKAQGF
RTTEYPGFPTDMQAQFMALNCIAQGTATVTETIFENRFMHVNELVRLGAKIQVDGKVAVI
EGVPRLSGATVMATDLRASASLVIAGLVAEGETVVDRIYHLDRGYDCMEAKLRGIGADIE
RVKA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactcctgattcgcggcggacgtagcttgcaaggcgatgtgctggtctccggc
gccaagaacgccgccttgccggagttgtgcgccgccctgctcacggcagagcccgtgacg
ctgctcaacgtgccccagctgcaggacgtgagcaccatgctcaagctgatccgcaacatg
ggcgtggcggcggagcgggccgatgacggcacggtgcgcatcaacgccagcgcgctgagc
acacccgaggcaccctacgaactggtcaagaccatgcgcgcttccgtgctggcgctgggc
ccgctgctggcgcgctttggcgaggccacggtgtcactgcccggcggctgcgccattggc
tcgcgcccggtggaccagcacatcaagggcctggccgccatgggggccgagatcgtggtc
gaacacggctacatgatcgccaagctgcccgcaggctggaagcgcctcaagggtgcgcgc
atcaccaccgacatggtcacggtgacgggcaccgagaacttcctcatggctgctgcgctg
gccgagggtgaaacggtgctggaaaacgccgcgcaagaacccgagatttcggacctggcc
gagatgctgattgcgatgggcgcaaagatcgaaggccatggcaccagccgcatccgcatc
cagggcgtcgaaaaactgcacggctgcacccaccgcgtggtggccgaccgcattgaagcg
ggtacctttttgtgcgccgtggccgccacgggcggtgatgtggtgttgcgccatggtcgt
gccgaccacctcgacgccgtcatcgaaaagctgcgcgaggccggtgccaccgtgcaggcc
gtggacggcggcatccgcgtgcaaagcgcgggcggcgccacgctcaaggcccagggcttt
cgcaccaccgaataccccggtttccccaccgacatgcaggcccagttcatggcgctcaac
tgcatcgcccagggtacggccacggtgaccgagacgatttttgaaaaccgcttcatgcac
gtcaacgagctggttcggctgggcgccaaaatccaggtggatggcaaggtggcagtgatt
gagggcgtgccccgcctgtccggcgccaccgtgatggccactgacctgcgtgcgtccgcc
agcctcgtcatcgcaggcctcgtggccgaaggcgaaaccgtggtggaccgcatctaccac
ctggaccgtggctacgactgcatggaagccaaactgcgcggcatcggcgctgacatcgaa
cgagtaaaagcatga

DBGET integrated database retrieval system