KEGG   Acidovorax sp. KKS102: C380_04785Help
Entry
C380_04785        CDS       T02290                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ack  Acidovorax sp. KKS102
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ack00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1051981..1052706
Genome map
AA seq 241 aa AA seqDB search
MSSQPAADMTPIPPDEGTPVSVKIRERLAAARKRFHANDNIAEFIEPGELEKLLDEVEVK
MQGVLDSLVINTEGDHNTNNTARRVAKMYLNEVFRGRYVAQPPITEFPNAEHLNELMIVG
PLTVRSACSHHFCPVIGKIWIGVMPNEHTNVIGLSKYARLVDWIMGRPQIQEEAVVQLAD
LIMEKTQPDGLAIVMEASHFCMSWRGVRDNDSRMINSVMRGVFLKDSALRREFLSLIPGK
N
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtccagccaacctgccgccgatatgacgcccatcccaccggacgaaggcacgcccgtt
tccgtcaagatccgagaacgccttgccgccgcgcgcaagcgctttcacgccaacgacaac
attgccgaattcatcgagcccggcgagctggagaagctgctcgacgaggttgaggtcaag
atgcagggcgtgctcgacagcctggtcatcaacaccgagggcgaccacaacaccaacaac
accgcgcgccgcgtggccaagatgtacctcaacgaggtgttccgtggtcgctacgtggcg
cagccgcccatcaccgaattcccgaacgccgagcacctcaacgagctgatgatcgtgggc
ccgctcaccgtgcgcagtgcctgcagccaccacttctgccccgtcatcggcaagatctgg
atcggcgtgatgcccaacgagcacaccaacgtgatcggcctgtccaaatacgcgcgcctg
gtggactggatcatgggccgtccccagatccaggaagaagccgtggtgcagctggccgac
ctgatcatggaaaagacccagcccgacggcctcgccatcgtcatggaagccagccacttc
tgcatgtcctggcgcggcgtgcgcgacaacgacagccgcatgatcaactcggtcatgcgc
ggcgtgttcctcaaggacagcgccctgcgccgtgaatttttgtccctcattcctggaaag
aactga

DBGET integrated database retrieval system