KEGG   Acidovorax sp. KKS102: C380_06035Help
Entry
C380_06035        CDS       T02290                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ack  Acidovorax sp. KKS102
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    C380_06035
Enzymes [BR:ack01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     C380_06035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1315316..1316875)
Genome map
AA seq 519 aa AA seqDB search
MTAHLHETGTGTGTGTGEDGVNTLQAWRTGIDTHQEPVVYMRRDCPVCRSEGFTTQARVQ
LTAGRRSIVATLSVVDGDWLAENVAGLSESAWASLGAQPGQLVTVTHAPPLDSLSHVRAK
VYGNALGDAEFSAIISDVAAGHYSDLHLATFITACAGDRLDLAETVSLTKAMIGVGDRID
WGRPLVVDKHCVGGLPGNRTTLLVVPIVAACGLTMPKTSSRAITSPAGTADTMEVLAPVN
LDVRSMRRVVERTGGCIVWGGSVRLSPADDILIRVERPLDLDSEGQLVASVLSKKAAAGS
THVLIDLPVGATAKVRSAQAAAALGRRLQEVGSAIGLHVALRVTDGEQPVGRGIGPALEA
RDVLAVLQGTPEAPADLRERALRLAADILEMGGAAPAGGGLTLATQVLADGRAWATFEAI
CAEQGGLRSIPVATHRHTVASPSTGRVSRIDNRLLARAAKLAGAPTAAAAGIDVHARLGD
QVEAGQPLFTLHAQAPGELAYALQFVRSRPPIFQISENL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgcacctgcacgagaccggcaccggcaccggcaccggcaccggagaggatggc
gtgaacacgctgcaggcgtggcgcaccggcatcgacacccatcaggagccggtggtctac
atgcggcgcgactgccctgtctgccggtcggagggtttcacgacccaggcgcgcgtgcag
ctgacggccggccgccgcagcatcgtggcgacgctcagcgtcgtcgatggggattggctg
gccgagaacgtcgctggcctgtccgaatcggcatgggcgtcgctgggggcgcagccgggc
cagctggtcacggtgacccatgcaccgccgctggattcgctcagccatgtccgggccaag
gtctacggcaatgccctgggcgatgccgagttcagcgccatcatctccgacgtcgcggcg
ggccattactctgacctgcatctggccaccttcatcaccgcctgcgccggcgatcgcctg
gacctcgcggagaccgtctcgctcacgaaagccatgattggcgtcggtgaccgcatcgat
tgggggcgcccgctggtggtggacaagcattgcgtcggcggcctgcccggcaaccgcacg
accctgctcgtggtgcccatcgtggccgcctgcggcctcacgatgcccaagacctcctcg
cgcgccatcacctcgccggccgggacggccgacacaatggaggtgctggcgccggtgaac
ctggatgtgcgaagcatgcggcgcgtggtcgaacgcacgggcggctgcatcgtctggggc
ggctcggtacggctcagccccgccgacgacatcctcatccgcgtcgagcggccgctggac
ctggacagcgagggccagctcgtcgcctcggtcctgtccaagaaggccgctgcgggctcg
acccatgtgctgatcgacctgcccgtgggtgccaccgccaaagtgcgcagcgcgcaggcc
gcggcggcgctcggtcggcgcctgcaggaggtgggcagcgccatcggcctgcacgtggcc
ttgcgcgtcaccgatggtgagcagccggtcggccgcgggatcggcccggcactggaggcc
cgcgacgtgctggccgtcctacaagggacgcccgaggccccggccgacctgcgggagcga
gcgttgcggctggcggcggacatcctcgaaatgggcggtgcagcgcccgccggcggcggc
ctgacgctcgccacgcaggtgctggccgacggccgcgcctgggccacgttcgaggcgatc
tgcgctgagcagggcggcctgcgcagcatcccggtggcaacgcatcggcacaccgtcgca
tcgccgtccacgggacgggtctcccgaatcgacaaccggctgctcgcgcgggcggccaag
ctcgccggagcaccgaccgccgctgccgccggcatcgacgtgcatgcgcgcctgggcgac
caggtcgaagcgggacagccgctcttcacgctgcacgcccaggcgccgggcgagctggcc
tatgcgctgcagttcgtccgctcgcgcccaccgatcttccagatttcggagaacctatga

DBGET integrated database retrieval system