KEGG   Acidovorax sp. KKS102: C380_07020Help
Entry
C380_07020        CDS       T02290                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
ack  Acidovorax sp. KKS102
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    C380_07020
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    C380_07020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1539690..1540022)
Genome map
AA seq 110 aa AA seqDB search
MAQSVERGAALYAAHCSSCHSPDQHEDGPAHRGVVGRRAGALKDFDYSPALRASKILWTR
ATLKAWLTDPEALIPGQGMDYQLDDAQDREDVVAYLATLKRLPAPVPAAR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggcccagtcggtggagcgtggcgctgcgctgtacgcagcgcattgcagcagttgccac
agccctgaccagcatgaagacggcccggcgcaccggggcgtggtggggcgccgcgctggc
gccctgaaggactttgactactcgccggccttgcgcgccagcaagatcctgtggacgcgg
gccacgctcaaggcctggctgacggaccccgaggcgctgatacccggccagggcatggac
taccagcttgacgatgcgcaggaccgcgaggacgtggtggcctatctggccacgctcaaa
cgcctgcccgcgccggtgccagcagcaaggtag

DBGET integrated database retrieval system