KEGG   Acidovorax sp. KKS102: C380_07020Help
Entry
C380_07020        CDS       T02290                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
ack  Acidovorax sp. KKS102
Pathway
ack02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ack00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    C380_07020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Auto_anti-p27 Cytochrom_C1
Motif
Other DBs
NCBI-ProteinID: AFU45113
UniProt: K0HQ28
Position
complement(1539690..1540022)
Genome map
AA seq 110 aa AA seqDB search
MAQSVERGAALYAAHCSSCHSPDQHEDGPAHRGVVGRRAGALKDFDYSPALRASKILWTR
ATLKAWLTDPEALIPGQGMDYQLDDAQDREDVVAYLATLKRLPAPVPAAR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggcccagtcggtggagcgtggcgctgcgctgtacgcagcgcattgcagcagttgccac
agccctgaccagcatgaagacggcccggcgcaccggggcgtggtggggcgccgcgctggc
gccctgaaggactttgactactcgccggccttgcgcgccagcaagatcctgtggacgcgg
gccacgctcaaggcctggctgacggaccccgaggcgctgatacccggccagggcatggac
taccagcttgacgatgcgcaggaccgcgaggacgtggtggcctatctggccacgctcaaa
cgcctgcccgcgccggtgccagcagcaaggtag

DBGET integrated database retrieval system