KEGG   Acidovorax sp. KKS102: C380_07280Help
Entry
C380_07280        CDS       T02290                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ack  Acidovorax sp. KKS102
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    C380_07280
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    C380_07280
Enzymes [BR:ack01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     C380_07280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1590886..1591977
Genome map
AA seq 363 aa AA seqDB search
MTEHAPLILDVAGTTLSADDRRRLAHPLTGGVILFARNWENRAQLLQLTSSIKAVRDDLL
ICVDHEGGRVQRFRTDGFTHLPPMRALGEMWMDDGKGAKAVPGSGALRATNAATAAGYVL
GAELRACGVDFSFTPVLDLDWGESGVIGDRSFHRDPRVVALLAKSLMHGLLQAGMANCGK
HFPGHGFVKADSHTEVPVDKRSLKAILADDAAPYPWLSSTLTSVMPAHVIYPKVDSRPAG
FSQRWLQDILRRQMRFDGAIFSDDLSMEGARRLDGQVVSYTDAAVAALEAGCDLVLLCNQ
SVGDGKAVDELIEGLEKAQQQGRWQPSLDSESRRLALLPETLPQAWDELMYQPAYLQALD
LLP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacacgcacctctgatcctcgacgtcgctggtaccaccctcagcgccgacgac
cgccgtcgcctggcgcacccgctcacgggcggcgtcatcctgtttgcccgcaactgggaa
aaccgcgcgcagctgctgcagctcaccagcagcatcaaggccgtgcgcgacgacctgctg
atctgtgtggaccacgagggcggccgcgtgcagcgctttcgcaccgatggtttcacccac
ctgccgcccatgcgcgcgctgggcgagatgtggatggacgatggcaagggcgccaaggcc
gtgcccggcagcggtgccctgcgcgccaccaacgcagccacggcggcgggctatgtgctg
ggcgcggagctgcgcgcctgcggcgtggacttcagctttacaccggtgctggacctcgat
tggggcgaaagtggtgtgatcggcgaccgctccttccaccgcgacccccgggtggtggcg
ctgctcgccaagagcctcatgcacggcctgctgcaggccggcatggccaattgcggcaaa
cactttccgggccacggtttcgtcaaggcggattcgcacaccgaggtacccgtagacaag
cgcagcctcaaggccatcctggccgacgatgcagcgccgtacccctggctcagcagcacg
ctcaccagcgtgatgccggcccacgtgatctatcccaaggtcgacagccgccccgccggt
ttttcgcagcgctggctgcaagacatcctgcgccgccagatgcgttttgacggcgccatc
ttcagcgacgacctcagcatggaaggggctcgccgactggacggccaggtggtcagctac
accgatgccgctgtggcggcgctggaggcaggttgcgacctggtgctgttgtgcaaccag
agcgtgggggatggcaaggccgtggacgaactcatcgaaggcctggaaaaggcccagcag
caaggccgctggcagcccagtttggacagcgaatcccgccgcctggcgctgctgcccgaa
accctgccgcaggcctgggacgaactcatgtaccagcctgcttacctgcaggcgctcgac
ctgttgccctga

DBGET integrated database retrieval system