KEGG   Acidovorax sp. KKS102: C380_07420Help
Entry
C380_07420        CDS       T02290                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ack  Acidovorax sp. KKS102
Pathway
ack00260  Glycine, serine and threonine metabolism
ack00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ack01100  Metabolic pathways
ack01110  Biosynthesis of secondary metabolites
ack01130  Biosynthesis of antibiotics
ack01230  Biosynthesis of amino acids
Module
ack_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C380_07420 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C380_07420 (trpA)
Enzymes [BR:ack01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     C380_07420 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: AFU45191
UniProt: K0I863
Position
complement(1619508..1620317)
Genome map
AA seq 269 aa AA seqDB search
MSRIASTFSALQAQGRKALIPYVTAGFPFADITPALMHGMVEAGADVIELGVPFSDPMAD
GPVIQKAGEKALSLGIGMVQVLDHVREFRKRNSTTPVVLMGYANPVERYDQKHGDGAFVR
DSAAAGVDGVLIVDYPPEECEAFAASLRAHGMDLIFLLAPTSTNERMAQVARVASGYVYY
VSLKGVTGSGALDTAAVEQMLPRIRQHVTIPVGVGFGIRDAATAQAIGKVADAVVIGSRI
IQLIEDQEHAKVVPLTIDFLRGIRKALDA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtatcgcatccaccttttctgccctgcaagcccagggccgcaaggcgctgatt
ccttatgtgaccgccggtttcccgtttgccgacatcacccccgcgctcatgcacggcatg
gtcgaggccggtgccgacgtgatcgagctgggcgtgcccttttccgaccccatggccgac
ggcccggtgatccagaaggcgggtgaaaaagccctcagcctgggcattggcatggtgcag
gtgctcgaccatgtgcgtgagttccgcaagcgcaacagcaccacgccagtggtgttgatg
ggctatgccaaccctgtggaacgctacgaccagaagcacggtgatggcgcgtttgtgcgc
gactctgccgctgcgggcgtggacggcgtgctcatcgtggactacccgcccgaagaatgc
gaagcctttgccgccagcctgcgcgcgcacggcatggacctgatcttcctgctggccccc
accagcacgaatgagcgcatggcccaggtggcgcgtgtggccagcggctatgtgtattac
gtatcgctcaagggcgtgaccggctcaggcgcgctggacacggcggccgtggagcagatg
ctgccccgtattcgccagcacgtgaccatcccggtgggtgtgggcttcggcatccgcgac
gccgccaccgcccaggccatcggcaaggtggccgatgccgtggtcatcggcagccgcatc
atccagttgattgaagaccaggagcacgccaaggtggtgcccctgaccatcgacttcctg
cgcggcatccgcaaggccctggacgcctag

DBGET integrated database retrieval system