KEGG   Acidovorax sp. KKS102: C380_07420Help
Entry
C380_07420        CDS       T02290                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ack  Acidovorax sp. KKS102
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    C380_07420 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C380_07420 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C380_07420 (trpA)
Enzymes [BR:ack01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     C380_07420 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1619508..1620317)
Genome map
AA seq 269 aa AA seqDB search
MSRIASTFSALQAQGRKALIPYVTAGFPFADITPALMHGMVEAGADVIELGVPFSDPMAD
GPVIQKAGEKALSLGIGMVQVLDHVREFRKRNSTTPVVLMGYANPVERYDQKHGDGAFVR
DSAAAGVDGVLIVDYPPEECEAFAASLRAHGMDLIFLLAPTSTNERMAQVARVASGYVYY
VSLKGVTGSGALDTAAVEQMLPRIRQHVTIPVGVGFGIRDAATAQAIGKVADAVVIGSRI
IQLIEDQEHAKVVPLTIDFLRGIRKALDA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtatcgcatccaccttttctgccctgcaagcccagggccgcaaggcgctgatt
ccttatgtgaccgccggtttcccgtttgccgacatcacccccgcgctcatgcacggcatg
gtcgaggccggtgccgacgtgatcgagctgggcgtgcccttttccgaccccatggccgac
ggcccggtgatccagaaggcgggtgaaaaagccctcagcctgggcattggcatggtgcag
gtgctcgaccatgtgcgtgagttccgcaagcgcaacagcaccacgccagtggtgttgatg
ggctatgccaaccctgtggaacgctacgaccagaagcacggtgatggcgcgtttgtgcgc
gactctgccgctgcgggcgtggacggcgtgctcatcgtggactacccgcccgaagaatgc
gaagcctttgccgccagcctgcgcgcgcacggcatggacctgatcttcctgctggccccc
accagcacgaatgagcgcatggcccaggtggcgcgtgtggccagcggctatgtgtattac
gtatcgctcaagggcgtgaccggctcaggcgcgctggacacggcggccgtggagcagatg
ctgccccgtattcgccagcacgtgaccatcccggtgggtgtgggcttcggcatccgcgac
gccgccaccgcccaggccatcggcaaggtggccgatgccgtggtcatcggcagccgcatc
atccagttgattgaagaccaggagcacgccaaggtggtgcccctgaccatcgacttcctg
cgcggcatccgcaaggccctggacgcctag

DBGET integrated database retrieval system