KEGG   Acidovorax sp. KKS102: C380_07425Help
Entry
C380_07425        CDS       T02290                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ack  Acidovorax sp. KKS102
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    C380_07425
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C380_07425
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C380_07425
Enzymes [BR:ack01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     C380_07425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1620318..1621601)
Genome map
AA seq 427 aa AA seqDB search
MNSYQQPDASGHFGPYGGSFVSETLTHAIQELREAYARYQNDPEFLAEFQYELKHFVGRP
SPIYHAARTSREMGGAQIYLKREDLNHTGAHKINNVIGQAMLAKRMGKPRVIAETGAGQH
GVATATICARYGLECVVYMGAEDVKRQSPNVYRMKLLGATVVPVESGSKTLKDALNDAMR
DWVANVDNTFYIIGTVAGPHPYPMMVRDFQSVIGKECIEQMPAMLTEQKVLGQQPDAVIA
CVGGGSNAMGIFHPYIPFEKTRLIGVEAAGEGLESGKHSASLQKGSAGVLHGNRTFILQD
DNGQITETHSISAGLDYPGVGPEHAWLQEIGRAEYVGITDQEALDAFHYLCRTEGIIPAL
ESSHAVAYAMKLAKTMRPDQSILVNLSGRGDKDIGTVADLSGADFYCRPSCQGQSVKGGE
QPIKVVK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaattcctatcagcaacctgatgcctccggccatttcggcccctacggcggcagcttc
gtcagcgaaaccctgacccacgccatccaggaactgcgcgaggcctacgcgcgctaccag
aacgacccggagtttctggccgaattccagtacgaactcaagcacttcgttggccgcccg
tctcccatctaccatgcggcgcgcaccagccgcgaaatgggcggcgcgcagatctacctc
aagcgcgaagacctgaaccacaccggcgcgcacaagatcaacaacgtgatcggccaggcc
atgctggccaagcgcatgggcaagccccgtgtgattgcagaaaccggcgcgggccagcac
ggcgtggccacggccaccatctgcgcccgctacggcctggaatgcgtggtgtacatgggc
gccgaagacgtgaagcgccagagccccaacgtgtaccgcatgaagctcctgggcgccacg
gtggtgcccgtggagtccggcagcaagactctgaaagacgcactgaacgacgccatgcgc
gactgggtagcgaatgtggacaacaccttctacatcatcggcaccgtggcgggcccacac
ccctaccccatgatggtgcgcgacttccagagcgtgatcggcaaggaatgcattgagcaa
atgcctgctatgctgaccgagcaaaaggtgctgggccagcaacccgatgccgtcatcgcc
tgcgtgggcggcggcagcaatgccatgggtatcttccacccctatatcccgttcgagaaa
acgcgcctgattggcgtggaagctgcgggtgaaggcctggagtcgggcaagcactccgca
tcgctgcaaaaaggcagcgcgggcgtgctgcacggcaaccgcaccttcatcttgcaggat
gacaacggccagatcaccgaaacccacagcatcagcgcgggcctggactaccccggcgta
ggccccgagcacgcctggttgcaggagatcggccgcgcggagtacgtcggcatcaccgac
caggaagcgctggacgccttccactacctgtgccgcaccgagggcatcatccctgcgctc
gaatccagccacgccgtggcctatgccatgaagctggccaaaaccatgcgcccagaccag
tcgatcctggtcaacctctcgggccggggcgataaggacatcggcacggtggccgacctg
agcggcgccgacttttactgccgacccagctgccaggggcagtccgtcaagggcggcgag
caacccatcaaggtggtgaaataa

DBGET integrated database retrieval system