KEGG   Acidovorax sp. KKS102: C380_07425Help
Entry
C380_07425        CDS       T02290                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ack  Acidovorax sp. KKS102
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    C380_07425
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C380_07425
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C380_07425
Enzymes [BR:ack01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     C380_07425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1620318..1621601)
Genome map
AA seq 427 aa AA seqDB search
MNSYQQPDASGHFGPYGGSFVSETLTHAIQELREAYARYQNDPEFLAEFQYELKHFVGRP
SPIYHAARTSREMGGAQIYLKREDLNHTGAHKINNVIGQAMLAKRMGKPRVIAETGAGQH
GVATATICARYGLECVVYMGAEDVKRQSPNVYRMKLLGATVVPVESGSKTLKDALNDAMR
DWVANVDNTFYIIGTVAGPHPYPMMVRDFQSVIGKECIEQMPAMLTEQKVLGQQPDAVIA
CVGGGSNAMGIFHPYIPFEKTRLIGVEAAGEGLESGKHSASLQKGSAGVLHGNRTFILQD
DNGQITETHSISAGLDYPGVGPEHAWLQEIGRAEYVGITDQEALDAFHYLCRTEGIIPAL
ESSHAVAYAMKLAKTMRPDQSILVNLSGRGDKDIGTVADLSGADFYCRPSCQGQSVKGGE
QPIKVVK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaattcctatcagcaacctgatgcctccggccatttcggcccctacggcggcagcttc
gtcagcgaaaccctgacccacgccatccaggaactgcgcgaggcctacgcgcgctaccag
aacgacccggagtttctggccgaattccagtacgaactcaagcacttcgttggccgcccg
tctcccatctaccatgcggcgcgcaccagccgcgaaatgggcggcgcgcagatctacctc
aagcgcgaagacctgaaccacaccggcgcgcacaagatcaacaacgtgatcggccaggcc
atgctggccaagcgcatgggcaagccccgtgtgattgcagaaaccggcgcgggccagcac
ggcgtggccacggccaccatctgcgcccgctacggcctggaatgcgtggtgtacatgggc
gccgaagacgtgaagcgccagagccccaacgtgtaccgcatgaagctcctgggcgccacg
gtggtgcccgtggagtccggcagcaagactctgaaagacgcactgaacgacgccatgcgc
gactgggtagcgaatgtggacaacaccttctacatcatcggcaccgtggcgggcccacac
ccctaccccatgatggtgcgcgacttccagagcgtgatcggcaaggaatgcattgagcaa
atgcctgctatgctgaccgagcaaaaggtgctgggccagcaacccgatgccgtcatcgcc
tgcgtgggcggcggcagcaatgccatgggtatcttccacccctatatcccgttcgagaaa
acgcgcctgattggcgtggaagctgcgggtgaaggcctggagtcgggcaagcactccgca
tcgctgcaaaaaggcagcgcgggcgtgctgcacggcaaccgcaccttcatcttgcaggat
gacaacggccagatcaccgaaacccacagcatcagcgcgggcctggactaccccggcgta
ggccccgagcacgcctggttgcaggagatcggccgcgcggagtacgtcggcatcaccgac
caggaagcgctggacgccttccactacctgtgccgcaccgagggcatcatccctgcgctc
gaatccagccacgccgtggcctatgccatgaagctggccaaaaccatgcgcccagaccag
tcgatcctggtcaacctctcgggccggggcgataaggacatcggcacggtggccgacctg
agcggcgccgacttttactgccgacccagctgccaggggcagtccgtcaagggcggcgag
caacccatcaaggtggtgaaataa

DBGET integrated database retrieval system