KEGG   Acidovorax sp. KKS102: C380_07560Help
Entry
C380_07560        CDS       T02290                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ack  Acidovorax sp. KKS102
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    C380_07560
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C380_07560
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    C380_07560
Enzymes [BR:ack01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     C380_07560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1648717..1650147
Genome map
AA seq 476 aa AA seqDB search
MKYLSTRGHADRKQFCDILLEGLAPDGGLYLPEHYPQVDDAMLTRLRKAYHEQGYAELAF
QILSLYIDDIPAADLKALCAKTYTAEVFGTGEIVPLRHLENSLWLEALSNGPTLAFKDMA
MQLLGNLFEYELGRRGEQLNILGATSGDTGSAAEYAMRGKAGVRVFMTSPHGRMSAFQQA
QMFSLQDENIHNIAIEGVFDDCQDIVKAVSNDHAFKHKYKIGTVNSINWARLLAQVVYYF
AGYIQATETNDQKVSFTVPSGNFGNVCAGHVARMMGLPIAKLVVATNENDVLDEFFRTGV
YRVRGSADTHETSSPSMDISKASNFERFVFDLLGRDGARTKALFGDALSKDGRFDLSQDP
CFADAAAKYGFESGKSTHADRLATIRDNYQRHGVTIDTHTADGVKVALEHHQDPNVPMIV
LETALPIKFAETIVEALGHAPERPAKFAGIEDLPKRVQVMPADVDLVKAYIERHCA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacctcagcacccgcggccatgcagaccgcaagcagttttgcgacatcctcctc
gaaggcctggcgcccgatggcggcctgtacctgcccgagcactacccgcaggtggatgac
gccatgctcacgcgcctgcgcaaggcctaccacgagcaaggctatgcagagctggcgttc
cagatcctgtcgctctacatcgacgacatccccgctgccgacctgaaggccctgtgcgcc
aagacgtacaccgctgaagtgttcggcacgggcgagatcgtgcccctgcgccacctggaa
aacagcctgtggctcgaagccctgtccaacggccccacactggccttcaaggacatggcc
atgcagttgctgggcaacctgttcgagtacgaattgggccgccgtggcgagcagctcaac
atcctgggcgccaccagcggcgacaccggcagcgcggccgaatacgccatgcgcggcaag
gcgggtgtgcgtgtgttcatgaccagcccgcacggtcgcatgagcgctttccagcaggcg
caaatgttcagcctgcaggacgagaacatccacaacatcgccatcgagggcgtgttcgac
gactgccaggacatcgtcaaggccgtctccaacgaccacgccttcaagcacaagtacaag
atcggcacggtcaactccatcaactgggcgcgcctgctggcgcaggtggtgtactacttt
gcgggctatatccaggccaccgagaccaacgaccagaaggtcagcttcacggtgcccagc
ggcaacttcggcaacgtgtgcgcaggccatgtggcgcgcatgatgggcctgcccattgcc
aagctggtggtggccaccaacgagaacgatgtgctcgacgagttcttccgcaccggcgtg
taccgcgtgcgtggcagcgcggacacgcacgaaacgtcgagcccgtccatggacatcagc
aaggccagcaacttcgagcgctttgtgttcgacctgctgggccgcgacggcgcgcgcacc
aaggcgttgtttggcgatgccctgtccaaggacgggcggtttgatctgagccaggatccg
tgctttgccgatgctgctgccaagtacggctttgaaagcggcaagagcacccatgccgac
cgcctggccaccatccgcgacaactaccagcgccatggagtaaccatcgacacccacacc
gccgacggggtgaaggtggccctggagcaccatcaggaccccaacgtgccgatgatcgtg
ctggagacggcgctgcccatcaagtttgccgagaccatcgtcgaagctctgggccatgcg
cccgagcggccagccaagtttgccggcatcgaagacttgcccaagcgggtgcaggtgatg
cccgccgatgtggatctggtcaaggcctacatcgagcgccattgcgcttga

DBGET integrated database retrieval system