KEGG   Acidovorax sp. KKS102: C380_07625Help
Entry
C380_07625        CDS       T02290                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ack  Acidovorax sp. KKS102
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    C380_07625 (tpiA)
   01230 Biosynthesis of amino acids
    C380_07625 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C380_07625 (tpiA)
   00051 Fructose and mannose metabolism
    C380_07625 (tpiA)
   00562 Inositol phosphate metabolism
    C380_07625 (tpiA)
Enzymes [BR:ack01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     C380_07625 (tpiA)
Exosome [BR:ack04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   C380_07625 (tpiA)
  Exosomal proteins of bladder cancer cells
   C380_07625 (tpiA)
  Exosomal proteins of melanoma cells
   C380_07625 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1659508..1660257
Genome map
AA seq 249 aa AA seqDB search
MNNKKKLIAGNWKMNGSLAANEALLKALIAGTAEVACDIAVAVPSPYLAQVQALTAGTTI
AVAAQDVSAHESGAYTGEVSVAMLKDFGVRYALVGHSERRQYHGETDAIVAEKAQRALAA
GVTPVVCVGETLQEREAGMTEAVVKRQLAAVIHLNGHCISEIVVAYEPVWAIGTGRTASP
EQAQAVHAVLRTQLAAASEHADRIRLLYGGSMNAANAAQLLAQPDIDGGLVGGASLKAPD
FLQIIAAAR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaagaaaaaactcatcgccggcaactggaagatgaatggcagcctggccgcc
aacgaggctttgttgaaggccttgattgcgggcaccgcagaggtggcttgtgatatcgct
gtcgcagtgccttcgccctatctggcgcaggtgcaggcattgacggctggcaccaccatt
gcggtggcggcgcaggatgtgtctgcgcacgagtcgggtgcctacaccggtgaggtatcg
gtggccatgctgaaggattttggtgtgcgctatgcgctggtggggcactctgagcgtcgc
cagtaccatggtgaaaccgatgcaatcgtggcggagaaagcccagcgcgcactggcggcg
ggtgtgactccagtcgtctgcgtgggtgaaactctgcaagagcgtgaagcgggcatgacc
gaggcggtggtcaagcgccagctcgccgcagtgatccatctgaacggccattgcatcagc
gagatcgtggtggcttacgaacctgtgtgggccatcggtacgggtcgcactgcgtcgccg
gagcaggcgcaagccgtgcatgcggtgctgcgcacccagctggcggctgcgagcgagcat
gcggatcgcatccgcttgctgtacggcggcagcatgaacgcagccaatgcggcccagctg
ctggcccagcccgatatcgacggcggcctggtcggcggtgcctcgttgaaggcgcccgac
ttcctacaaatcattgcggcagcccgttga

DBGET integrated database retrieval system