KEGG   Acidovorax sp. KKS102: C380_08330Help
Entry
C380_08330        CDS       T02290                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
ack  Acidovorax sp. KKS102
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1820787..1822322)
Genome map
AA seq 511 aa AA seqDB search
MADRPPSEIARETLKQLAARRLAPTPDNYLAIYDEIAGIRSPQPFPEGPLSSIQRVLPGQ
TPAQKRLLGQFERAIITKDWTSLQSVMVGYANLGLHPATASKPIEVADAPTALGELPTEF
AEALARLIDNTLPALGDDDPRVIDMAQQLITFLREPAPLVTTAQLMLGNFSYRLSFATEE
QASIRASLLELLHMIFENIAVLSVDDRWLQGQAEALMSASTPPLTLRRLDDMQRRLKDVI
FKQTEAKARSLEAQEQMKEMLATFIERLARITASSTSYQGTMERCADLIGKASTLQEIAP
VLQEVMSATRAMALDSRVTHDELQDLRERTEAKRAEVAKLQEELDRASAQARHDPLTGSL
NRKGLDEAVEREIARARRLGSSLCLALLDVDNFKTINDRLGHAGGDAALVHLAQVTREVM
RPQDLLARYGGEEFVIVLPDTTVEAGVAAMTRLQRELTTRFFLQGTEKVLITFSAGVAQL
SDSESATDAIVRADQAMYLAKRSGKNRVMAA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccgaccaccttccgagatcgcgcgcgagacgctcaaacaactggccgctcgc
cgactggcccccacgccagacaactacctcgcgatctacgatgaaatagcgggcatccgc
agcccgcagccgttccccgagggaccgctgagcagcatccagcgggtgctgcccggccag
acccccgcgcaaaaacgcctgctgggccagttcgaacgcgccatcatcaccaaggactgg
acgtcgctgcaaagcgtgatggtgggttacgccaacctgggtctgcacccggccacggcg
tccaaacccatcgaggtggctgatgcgcccaccgcactgggcgaactgcccaccgagttt
gccgaggccctggcccgcctcatcgacaacaccctgcccgcgctgggcgacgacgacccc
cgcgtcatcgacatggcgcagcagctcatcacctttctgcgcgagcccgccccactggtg
accaccgctcagctcatgctgggcaacttcagctaccgcctgtcgttcgccaccgaagaa
caagcctccatccgcgcgagcctgctggagctgctgcacatgatcttcgagaacatcgcc
gtgctcagtgtggacgaccgctggctgcagggccaggccgaggcgctgatgagtgcctcg
accccgccgctgacgctgcggcggctggacgatatgcagcgccggctcaaggacgtgatc
ttcaagcagaccgaagccaaggcccggtcgctggaggcgcaagagcagatgaaggaaatg
ctggccaccttcatcgagcggctggcgcgcatcaccgcatccagcaccagctaccagggc
accatggagcgttgcgccgacctgatcggcaaggccagcaccctgcaggagatcgccccg
gtgctgcaggaagtgatgagcgccacccgcgccatggcgctggacagccgcgtgacgcac
gacgaactgcaagacctgcgcgagcgcaccgaggccaagcgcgccgaggtcgccaaactg
caggaagaactggaccgcgccagcgcccaggcgcgccacgacccgctgaccggcagcctc
aaccgcaagggcctggacgaggcggtggaacgcgagatcgcccgcgcccgccgcctgggc
tcgtcgctgtgcctggcgctgctggacgtggacaacttcaagaccatcaacgaccggctg
ggccatgccgggggcgacgctgccctggtgcacctggcgcaggtcacgcgcgaagtcatg
cggccgcaggacctgttggcccgctatggcggcgaagagttcgtgatcgttctgccagac
accacggtcgaagccggtgtggcggccatgacccgcttgcaacgcgagctgaccacgcgc
tttttcttgcaaggcacggagaaggtgctcatcaccttcagcgcgggcgtggcccagttg
agtgacagcgagagcgccaccgacgccatcgtgcgggccgaccaggcgatgtatctcgcc
aagcgctcgggcaagaaccgggtgatggcggcttga

DBGET integrated database retrieval system