KEGG   Acidovorax sp. KKS102: C380_09360Help
Entry
C380_09360        CDS       T02290                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ack  Acidovorax sp. KKS102
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ack00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    C380_09360 (recR)
DNA repair and recombination proteins [BR:ack03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      C380_09360 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2041277..2041867
Genome map
AA seq 196 aa AA seqDB search
MSSTNSLDVLIQALRRLPGVGVKSAQRMAFHLLQHDREGALALSRALGEAVGTVHHCARC
HTFTEAEVCSTCLDPERDATRLCVVETPADQSALERTGAFKGLYFVLMGRLSPLDGVGPK
EIGLHKLMDRATDGTVQEVILATNFNAEGEATAHVISEALKSRGLHVTRLARGVPVGSEL
EYVDLGTIAHALVDRR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccaccaactccctcgatgttctgatccaggcgctgcgccggctgccgggggtg
ggggtgaagtctgcgcagcgcatggcgtttcatctgctgcagcacgaccgtgaaggggcg
ctggcgctgtcacgtgccctgggggaggcggtgggcaccgtgcaccactgcgcgcgttgc
catacgttcaccgaggccgaggtgtgcagcacctgcctggaccccgagcgcgatgccacg
cggctgtgtgtggtcgagacgccagcggaccagtcggcgctggagcgcacgggcgccttc
aaggggttgtactttgtgctgatggggcggctcagtccgctggatggggtggggccgaag
gagataggcctgcacaagctcatggaccgcgccacggacggcaccgtgcaggaggtgatt
ctggcgaccaatttcaatgccgagggcgaggccacagcccatgtgatcagcgaggcgctc
aaaagccgggggctccatgtcacgcggcttgcgcgcggcgtgccagtgggcagcgaactg
gagtacgtggacctgggcacgattgcgcatgcgctggtggatcgccggtga

DBGET integrated database retrieval system