KEGG   Acidovorax sp. KKS102: C380_10910Help
Entry
C380_10910        CDS       T02290                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ack  Acidovorax sp. KKS102
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    C380_10910
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C380_10910
  Amino acid metabolism
   00310 Lysine degradation
    C380_10910
Enzymes [BR:ack01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     C380_10910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2368134..2369399
Genome map
AA seq 421 aa AA seqDB search
MAIVEVKVPQLSESVAEATMLTWKKKAGEAVAVDEILIEIETDKVVLEVPAPAAGVLAEI
IQGDGATVVADQLIAKIDTEGKAGAAAPAPAAAAPVAAAAPAAAPAATGSSKGDVAMPAA
AKLLADNNLSVSAVAGSGKDGRVTKGDVLAAVAGGAKAAVAAPSVIPTGVPTKALPQVAA
PAGKEDLSGRPEQRVPMSRLRARVAERLLQSQSTNAILTTFNEVNMAPVMDLRKKFQDSF
TKEHGTKLGFMSFFVKAAVHALKKYPVLNASVDGNDIVYHGYFDIGIAVGSPRGLVVPIL
RNADQMSFADIEKKIAEFGKKAAEGKLGIEEMTGGTFSISNGGTFGSMLSTPIINPPQSA
ILGVHATKDRAVVENGQIVIRPMNYLAMSYDHRIIDGREAVLGLVAMKDALEDPSRLLFD
I
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctgtccgaatccgtggccgaagccaccatg
ctgacctggaagaaaaaggccggtgaagccgtggctgtggacgaaatcctgatcgaaatc
gaaaccgacaaggttgtgctcgaagtgccagcgcccgccgctggcgtgctggcagaaatc
atccagggcgacggcgccaccgtggtggcggaccagctcatcgccaagatagacaccgaa
ggcaaggccggtgctgcagctcctgctccggcagccgcagctcccgtggctgcggcagca
cctgctgccgcccccgcagctactggcagctccaagggcgatgtggccatgcctgccgcc
gccaagctgttggccgacaacaacctgtctgtctcggctgtggccggctcgggcaaggat
ggccgcgtgaccaagggtgatgtgctggccgctgtggcgggcggcgccaaggctgccgtg
gctgcgcccagcgtgattcccactggcgtgcccaccaaggcactgccccaggtggcagcg
cctgccggcaaggaagacctgagcggccgtcccgagcagcgcgtgcccatgagccgcctg
cgcgcccgtgtggccgagcgtctgctgcagtcgcagtcgaccaacgccatcctgaccacc
ttcaacgaagtgaacatggcccccgtgatggacctgcgcaagaagttccaggacagcttc
accaaggaacacggcaccaagctgggcttcatgtccttcttcgtgaaggctgctgtgcac
gccctgaagaagtaccccgtgctgaatgcatcggtggacggcaacgacatcgtctaccac
ggctatttcgacatcggtatcgccgtgggttcgccacgcggtttggtggtgcccatcctc
cgcaatgcagaccagatgagcttcgccgacatcgagaagaagatcgccgagttcggcaag
aaggctgctgaaggcaagctgggcattgaagaaatgaccggcggtacgttctccatctcc
aatggcggcacgttcggctccatgctgtccacacccatcatcaacccgccccagtcggcc
atcctgggcgtacacgccaccaaggaccgcgccgtggtcgaaaacggccagatcgtgatc
cgcccgatgaactacctggccatgtcctatgaccaccgcatcatcgacggccgcgaagcc
gtgctgggcctggtggcgatgaaggacgcgctggaagacccatcgcgcctgctgttcgac
atctga

DBGET integrated database retrieval system