KEGG   Acidovorax sp. KKS102: C380_11150Help
Entry
C380_11150        CDS       T02290                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ack  Acidovorax sp. KKS102
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    C380_11150
Enzymes [BR:ack01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     C380_11150
   3.1.2  Thioester hydrolases
    3.1.2.-  
     C380_11150
Lipid biosynthesis proteins [BR:ack01004]
 Fatty acid synthase
  Component type
   C380_11150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2427729..2428409)
Genome map
AA seq 226 aa AA seqDB search
MIRNLQQRRHFILSASIGLVVGLCAPTAFAQAAAKAGTAGRPSVILVLGDSLSAEYGLAR
GTGWVALLEKQLAQDKLAATVVNASVSGETTSGGRSRLAALLAQHKPSHVVIELGGNDAL
RGLPLKNTEENLAWMTQAAQKAGAKVLLVGMQVPPNYGTDYANKFAGLFTTVAQTHKAAV
VPFFLKGVADGPDPTRLFQPDRIHPRAEAHPQMLANVWPELKKLLR
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
ttgattcgcaatctgcagcaacggcgccactttatcctgagcgcatctatcggcctggtg
gtggggctttgtgcgcccacggcctttgcgcaggccgccgccaaggcagggactgccgga
cgcccttcggtgattctggtgctgggggattcgctcagcgccgaatacggcctggcgcgg
ggcacgggctgggtggcactgctggaaaaacaactggcgcaagacaagctcgcagccacc
gtggtcaatgccagcgtgagcggcgagaccacctcgggcggccgctcgcgcctggctgca
ctgctcgcgcagcacaagcccagccatgtggtgattgaactggggggcaacgatgccctg
cgcggcctgccgctcaagaacaccgaagagaacctggcctggatgacccaggcggcgcaa
aaggccggggccaaggtcttgctggtgggcatgcaggtgccgcccaactatggcaccgac
tacgcgaacaagtttgcgggcctgttcaccaccgtggcgcagacccacaaggcggctgtg
gtgccatttttcttgaagggtgtggctgacggaccggacccgacccgcctgttccagccc
gaccgcattcaccctcgcgccgaagcgcatccgcagatgctggccaacgtgtggccagag
ctcaaaaagctgctgcgttag

DBGET integrated database retrieval system