KEGG   Acidovorax sp. KKS102: C380_11625Help
Entry
C380_11625        CDS       T02290                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ack  Acidovorax sp. KKS102
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C380_11625
   00330 Arginine and proline metabolism
    C380_11625
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    C380_11625
Enzymes [BR:ack01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     C380_11625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2530305..2531231
Genome map
AA seq 308 aa AA seqDB search
MDRAALETLQSFLVGLDARMKRAHKRGQVAHYIPQLASVDVHQFGISVCLASGEQLSAGD
AATPFSIQSISKVFSLAIALGRHGDRLWKRVGKEPSNYTFNSVIELEQEGGKPRNPFVNA
GALVTTDAMLDAPDACGGLDELMDFVRTAAGDDRISIDEQVAASEYRTAYRNFSLAYFLR
SCGNLHTECERLLQIYCRQCAIAMNCQQLASVGRFLAGFDSAAHLLSPAQARSVNALMLV
AGHYDGSGDFAYSVGFPGKSGVGGGILAVVPGHASIAVWSPGLNAFGNSLLGTRALQELS
EFTGWSVF
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtgccgctttggaaacgctccagagctttctggtagggctcgacgcgcgcatg
aagcgcgcacacaaacgcggccaggtggcgcactacattccgcaactggccagcgttgat
gtgcatcagttcgggatcagtgtgtgcctggccagtggtgagcagctgagcgcgggcgac
gctgcgacaccgttttcgatccagagcatctcaaaggtcttctcactggcgatcgcattg
ggccgtcacggcgaccggctctggaagcgggtgggcaaggaaccatctaactacaccttc
aactcggtcattgagcttgagcaggaaggcggcaaaccgcgcaatcctttcgtcaatgcg
ggtgcactggtcaccaccgacgccatgcttgatgcgcccgacgcgtgcggcggactcgac
gaactgatggatttcgttcgcacggcggctggagatgaccggatctcgattgatgaacag
gttgccgcctcggaataccgcacggcctaccgcaatttctccctggcgtactttctacgc
tcgtgcggcaatctgcacacggaatgcgaacggcttctgcagatttactgtcgccaatgc
gcgatcgcgatgaactgccagcaattggccagcgtcggccggttcctggccggcttcgac
tccgcagcccacctgctgagcccagctcaggcacgcagtgtcaacgccttgatgctggtc
gcggggcactatgatggttcaggcgacttcgcctattcggtcggcttccccggcaagagt
ggcgtcggaggcggcattcttgccgtcgttccgggacatgcatcgatcgctgtctggtct
cctggcctgaatgcgtttggcaattcactgctcggcacgcgcgcgctgcaagagttgtca
gagttcactggctggtcggtgttctga

DBGET integrated database retrieval system