KEGG   Acidovorax sp. KKS102: C380_14220Help
Entry
C380_14220        CDS       T02290                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ack  Acidovorax sp. KKS102
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    C380_14220
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    C380_14220
Enzymes [BR:ack01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     C380_14220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3114960..3116291)
Genome map
AA seq 443 aa AA seqDB search
MPQSLNEQLSREQQIAALEKDWATNPRWKGVKRGYSAADVVRLRGSLPIEHTLAKRGAEK
LWDKINGGAKKGYVNAFGAISAGQAMQQAKAGLEAVYLSGWQVAADGNTSETMYPDQSLY
AYDSVPTMVRRINNTFKRADEIQWGRGINPGDKEFIDYFLPIVADAEAGFGGVLNAFELM
KNMIAAGAAGVHFEDQLAAVKKCGHMGGKVLVPTQEACEKLIAARFAADVMGVSTIVLAR
TDAEAANLITSDHDANDKPFLTGERTQEGFYRVKNGLEQAISRGVAYAPYADLVWCETGV
PDIGFAREFAQAVHAACPGKLLSYNCSPSFNWKKNLNDKQIASFQEDLSALGYKYQFITL
AGIHINWFNTFQFAHAYAQGEGMKHYTEMVQEPEFAAREKGYTFVSHQQEVGAGYFDDVT
TVIQGGSSSVKALTGSTEEEQFH
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgccccaatccctcaacgaacaactgagccgcgaacagcaaattgccgccctggaaaaa
gactgggcgaccaacccccgctggaagggcgtgaagcgtggttactccgcagccgacgtg
gtgcgcctgcgtggctcgctgcctatcgagcacacgctggccaagcgcggcgctgaaaag
ctctgggacaagatcaacggcggcgccaagaagggctacgtgaacgctttcggcgccatt
tctgccggtcaagccatgcagcaagccaaggccggcctcgaagccgtgtacctgtcgggc
tggcaagtggctgccgacggcaacaccagcgaaaccatgtaccccgaccagtcgctgtac
gcgtatgactcggtgcccaccatggttcgccgcatcaacaacaccttcaagcgcgctgac
gaaatccagtggggccgtggcatcaaccccggcgacaaggaattcatcgactacttcctg
ccgatcgtggccgacgcggaagccggctttggcggcgtgctgaacgccttcgaactgatg
aagaacatgatcgccgcaggtgcagccggcgttcacttcgaagaccagctggctgccgtg
aagaagtgcggccacatgggcggcaaggtgctggtgcctacgcaagaagcctgcgaaaag
ctgatcgctgcacgctttgccgctgacgtgatgggtgtgtccaccatcgtgctggcccgt
accgacgccgaagccgccaacctgatcacgtccgaccacgacgccaacgacaagcctttc
ctgaccggcgagcgcacgcaagaaggcttctaccgcgtgaagaacggtctggaacaagcc
atcagccgtggcgtggcgtatgccccttatgcggacctggtgtggtgcgaaaccggcgtg
ccagacatcggttttgcccgtgagtttgcgcaagctgtgcacgctgcctgccctggcaag
ctgctgtcgtacaactgctcgccatcgttcaactggaagaagaacctcaacgacaagcag
atcgcttcgttccaggaagacctgtcggctctgggctacaagtaccagttcatcacgctg
gccggtatccacatcaactggttcaacaccttccagttcgcccatgcatacgctcagggc
gaaggcatgaagcactacaccgaaatggtgcaagagccagaattcgcagcacgtgaaaag
ggctacaccttcgtgtcgcaccaacaagaagtgggcgcaggctacttcgacgacgtgacc
accgtgatccagggcggctcgtcctccgtgaaggccctgacgggttcgactgaagaagag
cagttccactga

DBGET integrated database retrieval system