KEGG   Acidovorax sp. KKS102: C380_14485Help
Entry
C380_14485        CDS       T02290                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ack  Acidovorax sp. KKS102
Pathway
ack00071  Fatty acid degradation
ack00280  Valine, leucine and isoleucine degradation
ack00281  Geraniol degradation
ack00310  Lysine degradation
ack00360  Phenylalanine metabolism
ack00362  Benzoate degradation
ack00380  Tryptophan metabolism
ack00410  beta-Alanine metabolism
ack00627  Aminobenzoate degradation
ack00640  Propanoate metabolism
ack00650  Butanoate metabolism
ack00903  Limonene and pinene degradation
ack00930  Caprolactam degradation
ack01100  Metabolic pathways
ack01110  Biosynthesis of secondary metabolites
ack01120  Microbial metabolism in diverse environments
ack01130  Biosynthesis of antibiotics
ack01212  Fatty acid metabolism
Module
ack_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    C380_14485
   00650 Butanoate metabolism
    C380_14485
  Lipid metabolism
   00071 Fatty acid degradation
    C380_14485
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C380_14485
   00310 Lysine degradation
    C380_14485
   00360 Phenylalanine metabolism
    C380_14485
   00380 Tryptophan metabolism
    C380_14485
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C380_14485
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C380_14485
   00281 Geraniol degradation
    C380_14485
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C380_14485
   00627 Aminobenzoate degradation
    C380_14485
   00930 Caprolactam degradation
    C380_14485
Enzymes [BR:ack01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C380_14485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFU46596
UniProt: K0IBD7
Position
3172595..3173380
Genome map
AA seq 261 aa AA seqDB search
MSEASEVLVSRDGAIATLTINRPRAKNSLNRAVFDGLRAQLVQLRDDDTVRAVIITGAEG
VFCAGADITAFDALRAEPLLGDRAAAGGHFWSELERFPKPVIAAVEKLALGGGTELALAC
DIAIAGESANFGVPEVKLGAIPGAGGTQRLIHAIGKSKAMALLLTGDFIDARMACDAGMV
AEVTADGQALPTALAMANRIAANSPLAVALAKDAALASFETPLAQGLEHEKRNFLVALRS
ADNLEGQAAFLGKRTPNFTGQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagccagcgaagtgctcgtcagccgcgatggcgccatcgccaccttgaccatc
aaccgcccgcgcgcgaagaacagcttgaaccgcgcggtattcgatggcctgcgtgcgcag
cttgtgcaactgcgcgacgacgataccgtgcgcgcggtcatcatcaccggcgccgagggc
gtgttctgcgccggggccgacatcacggccttcgatgcgctgcgcgccgagccgctgctg
ggcgatcgtgcggcggcaggcggccacttttggtcggaactggagcgcttccccaagccc
gtcatcgcagcggtggaaaagctcgcgctgggcggcggcacagaattagcgctggcctgc
gacatcgcgatcgctggcgagtccgccaatttcggtgtgccggaagtcaagctgggcgcc
attccgggtgccgggggcacgcagcgcctgatccacgctatcggcaagtccaaggccatg
gccctgctgctgaccggcgatttcatcgacgcccgcatggcttgcgatgcaggcatggtc
gccgaagtgacggctgatggccaggccctgccgacggcgttggcgatggccaaccggatt
gcagccaattcgccgctggccgtggcgctggcgaaagatgcggcactggccagctttgaa
actccgctcgcgcaaggcctggagcatgagaagcgcaatttcctcgtcgctttgcgttcg
gccgacaacctggaagggcaagcggcattcctaggcaagcgcacacccaactttaccggc
caatag

DBGET integrated database retrieval system