KEGG   Acidovorax sp. KKS102: C380_15610Help
Entry
C380_15610        CDS       T02290                                 

Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
ack  Acidovorax sp. KKS102
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    C380_15610
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C380_15610
Enzymes [BR:ack01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     C380_15610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3408677..3410164)
Genome map
AA seq 495 aa AA seqDB search
MISSTPEWIARSVSRLRTAAPAADKAGDKLAKAALDKTVTDVVAKVAVPRSTHERLQATL
RRGQEALSPRALRRLLADLQEVVAPQVSEIEGGRRAQVVAEWYAKAEPEERRDMWLLMCE
QFAPDATRFKSARQRYEAAAGTAEEGQAEISLRRALVSPRTRLLQRFSAFPEGMRFLVDM
RAEILPLLKADKRLLPLDAELEHLFSTWFDVAFLELRRLSWDSPASLLEKLIKYEAVHDI
RSWADLKNRLDSDRRCYGFFHPRLPNEPLIFVEVALLDKISSSITPLLDEAAAPVDITRA
TTAIFYSISNTQTGLRGVSFGDSLIKHVVETLTAEFPRLRTFATLSPIPGFRAWLGKHAG
AMLDRLDDKRRSELGRAVGFEPPQATHFLGALDKALELDAKSPVRQMLLECAAYYLGREL
QEGKPADPVARFHLGNGARVERLNWAGDPSSKGQKQSYGLMVNYLYDLKRIDKHRSLLAQ
GKVPVSGDIDSLCRD
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcagcacccccgaatggatcgcccgcagcgtgtcacgcctgcgcactgccgca
cccgccgccgacaaggcgggtgacaagctcgccaaggccgcgctcgacaaaaccgtgacc
gatgtggtcgccaaggtggcggtgccgcgttccacccacgagcgcctgcaggccaccctg
cgccgcggccaggaggcgctgtctccccgcgcgctgcgccgcctgctggccgacctgcag
gaggtggtggcgccgcaggtgagcgagatcgaaggtggccgccgcgcccaggtggtggcc
gagtggtatgccaaggccgagcccgaggagcggcgcgacatgtggctgctgatgtgcgag
cagtttgcgcccgacgccacgcgcttcaagtccgcccgccagcgctacgaggcagcagcg
ggcacggccgaagaaggacaggccgagatcagcctgcgccgcgctttggtgtcgccccgc
acgcggctgctgcagcggttttcggcgttccctgaaggcatgcgctttctggtggacatg
cgcgcagagatcctgccgctgctcaaggccgacaagcgcctgctgccgctcgatgccgag
ctggagcacctgttctcgacctggtttgatgtggcgtttctggagctgcgccgcctgtcg
tgggactcgcctgcatccctgcttgaaaagctcatcaagtacgaggccgtgcacgacatc
cgcagctgggctgacctgaagaaccggctggacagtgaccgccgctgctacggcttcttc
cacccgcgcctgcccaacgagccgttgatcttcgtggaggtggcgttgctcgacaagatc
tcgtccagcatcacgccgctcctggacgaggccgctgcgcccgtggacatcacgcgagcc
accacggccatcttctactccatcagcaacacacaaaccggcctgcgcggcgtgagcttt
ggcgactcgctgatcaagcatgtagtggagacgctcacggccgagtttccgcgcctgcgc
acctttgccacgctgtcgcccatcccgggtttccgtgcttggctgggcaaacacgcgggt
gcgatgctggaccgcctggacgataagcgccgcagcgaactgggccgcgcggtggggttc
gagccgccgcaggccacgcattttctcggggcgttggacaaggcgctggagctggacgct
aaatcccctgtgcgccagatgctgctggaatgcgccgcgtactatctgggccgcgagctg
caagaaggcaagccggcagaccccgtggcccgcttccacctgggcaacggcgcgcgggta
gagcgcctgaactgggcgggtgatccgtccagcaaggggcaaaaacaatcgtacgggctc
atggtgaactacctgtacgacttgaagcgcatcgacaagcatcgcagcttgcttgcgcag
ggcaaagtgccagtgtcgggggacatcgacagcctttgccgcgactga

DBGET integrated database retrieval system