KEGG   Acidovorax sp. KKS102: C380_15910Help
Entry
C380_15910        CDS       T02290                                 

Gene name
bphG
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ack  Acidovorax sp. KKS102
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    C380_15910 (bphG)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    C380_15910 (bphG)
   00650 Butanoate metabolism
    C380_15910 (bphG)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    C380_15910 (bphG)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C380_15910 (bphG)
   00622 Xylene degradation
    C380_15910 (bphG)
   00621 Dioxin degradation
    C380_15910 (bphG)
Enzymes [BR:ack01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     C380_15910 (bphG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3465701..3466651
Genome map
AA seq 316 aa AA seqDB search
MTRKLKAAIIGSGNIGTDLMIKIIRHGRFIEMGAMVGIDPASDGLARAQRLGVATTHEGA
EGLTRLPVFADIDIVFDATSAGAHVKNDALLRHHKPAMRVIDLTPAAIGPYCIPVVNGED
HLDALNVNMVTCGGQATIPMVAAVSRVAKVQYGEIVASISSKSAGPGTRANIDEFTETTS
KAIEVVGGAAKGKAIIVLNPAEPPLIMRDTVYTLSDFADTAKIEDSVQRMAAAVQAYVPG
YRLKQRVQFDRIEADRPIRIPGVGDRLTGLKTSVFLEVEGAAHYLPAYAGNLDIMTSAAL
RTAEKMAERLLATLTA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcaaactcaaggctgccatcatcggtagcggcaacatcggtaccgacctgatg
atcaagatcatcaggcacggccgattcatcgaaatgggcgccatggtcggaatcgaccca
gcctccgacggcctagcgcgcgcgcagcgcttgggcgtcgccaccacccacgagggtgct
gaaggcctgacgcgactgccggtattcgccgacattgacatcgtgttcgacgccaccagt
gcgggcgcgcacgtaaagaatgatgccctgctgcgccatcacaaacccgcgatgcgcgtg
atcgacctcacgcccgcggccatcggcccctactgtatcccggtggtcaacggcgaagac
cacctggacgcgctgaacgtgaacatggtcacctgcggtggccaggccaccattcccatg
gtggcggccgtctcgcgcgtggccaaggtgcagtacggcgaaatcgtcgccagcatctcc
agcaagagcgccggcccgggcacgcgcgccaacatcgacgagttcaccgaaaccacctcc
aaggccatcgaagtggtgggcggcgccgccaagggcaaggccatcatcgtcctgaacccg
gccgagccgccgctgatcatgcgtgacacggtctacaccctgagcgatttcgccgacacc
gccaagatcgaggactcggtgcagcgcatggccgccgcagtgcaggcttatgtgcccggc
taccgcctgaagcagcgtgtgcagtttgaccgcatcgaggccgaccggccgatccgcatc
cctggcgtgggcgatcggctcaccgggctgaagacctcggtcttcctggaggtcgagggt
gccgcccactacctgccagcctacgccggcaacttggacatcatgaccagcgccgcgctg
cgcaccgccgagaagatggccgagcgcctgctcgctaccctgaccgcctga

DBGET integrated database retrieval system