KEGG   Acidovorax sp. KKS102: C380_15910Help
Entry
C380_15910        CDS       T02290                                 

Gene name
bphG
Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ack  Acidovorax sp. KKS102
Pathway
ack00360  Phenylalanine metabolism
ack00362  Benzoate degradation
ack00620  Pyruvate metabolism
ack00621  Dioxin degradation
ack00622  Xylene degradation
ack00650  Butanoate metabolism
ack01100  Metabolic pathways
ack01120  Microbial metabolism in diverse environments
ack01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    C380_15910 (bphG)
   00650 Butanoate metabolism
    C380_15910 (bphG)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    C380_15910 (bphG)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C380_15910 (bphG)
   00622 Xylene degradation
    C380_15910 (bphG)
   00621 Dioxin degradation
    C380_15910 (bphG)
Enzymes [BR:ack01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     C380_15910 (bphG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AFU46877
UniProt: E7FJA9
Position
3465701..3466651
Genome map
AA seq 316 aa AA seqDB search
MTRKLKAAIIGSGNIGTDLMIKIIRHGRFIEMGAMVGIDPASDGLARAQRLGVATTHEGA
EGLTRLPVFADIDIVFDATSAGAHVKNDALLRHHKPAMRVIDLTPAAIGPYCIPVVNGED
HLDALNVNMVTCGGQATIPMVAAVSRVAKVQYGEIVASISSKSAGPGTRANIDEFTETTS
KAIEVVGGAAKGKAIIVLNPAEPPLIMRDTVYTLSDFADTAKIEDSVQRMAAAVQAYVPG
YRLKQRVQFDRIEADRPIRIPGVGDRLTGLKTSVFLEVEGAAHYLPAYAGNLDIMTSAAL
RTAEKMAERLLATLTA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcaaactcaaggctgccatcatcggtagcggcaacatcggtaccgacctgatg
atcaagatcatcaggcacggccgattcatcgaaatgggcgccatggtcggaatcgaccca
gcctccgacggcctagcgcgcgcgcagcgcttgggcgtcgccaccacccacgagggtgct
gaaggcctgacgcgactgccggtattcgccgacattgacatcgtgttcgacgccaccagt
gcgggcgcgcacgtaaagaatgatgccctgctgcgccatcacaaacccgcgatgcgcgtg
atcgacctcacgcccgcggccatcggcccctactgtatcccggtggtcaacggcgaagac
cacctggacgcgctgaacgtgaacatggtcacctgcggtggccaggccaccattcccatg
gtggcggccgtctcgcgcgtggccaaggtgcagtacggcgaaatcgtcgccagcatctcc
agcaagagcgccggcccgggcacgcgcgccaacatcgacgagttcaccgaaaccacctcc
aaggccatcgaagtggtgggcggcgccgccaagggcaaggccatcatcgtcctgaacccg
gccgagccgccgctgatcatgcgtgacacggtctacaccctgagcgatttcgccgacacc
gccaagatcgaggactcggtgcagcgcatggccgccgcagtgcaggcttatgtgcccggc
taccgcctgaagcagcgtgtgcagtttgaccgcatcgaggccgaccggccgatccgcatc
cctggcgtgggcgatcggctcaccgggctgaagacctcggtcttcctggaggtcgagggt
gccgcccactacctgccagcctacgccggcaacttggacatcatgaccagcgccgcgctg
cgcaccgccgagaagatggccgagcgcctgctcgctaccctgaccgcctga

DBGET integrated database retrieval system