KEGG   Acidovorax sp. KKS102: C380_16925Help
Entry
C380_16925        CDS       T02290                                 

Definition
succinate dehydrogenase subunit D
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
ack  Acidovorax sp. KKS102
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:ack01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ack00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ack00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:ack00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3684070..3684435
Genome map
AA seq 121 aa AA seqDB search
MSVNYGSKRVVVGAHYGLRDWLSQRVTAVLMALFTLALLAQVIFSKGPIGYDKWAGIFSA
QWMKVLTFSVIVAIAWHAWVGLREVLMDYIKPVGLRLALQVFSIVWLVSCAGWGIQVLWR
L
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcaattacggttccaagcgcgtcgtcgtcggcgcccactatggtctgcgcgac
tggctcagccagcgcgtcacggcagtcctgatggcgctgttcaccctggcgctgctggcc
caggtcatcttttccaaaggccccatcggctacgacaaatgggcgggcatcttctcggcc
cagtggatgaaggtgctgaccttctccgtgatcgtcgcgatcgcctggcatgcgtgggtc
ggcctgcgcgaagtcctgatggactacatcaagcccgtgggcctgcgcctggcactgcaa
gtgttcagcatcgtctggctggtcagctgcgccggctggggcatccaggttctgtggcgt
ctctga

DBGET integrated database retrieval system