KEGG   Acidovorax sp. KKS102: C380_16925Help
Entry
C380_16925        CDS       T02290                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ack  Acidovorax sp. KKS102
Pathway
ack00020  Citrate cycle (TCA cycle)
ack00190  Oxidative phosphorylation
ack00650  Butanoate metabolism
ack01100  Metabolic pathways
ack01110  Biosynthesis of secondary metabolites
ack01120  Microbial metabolism in diverse environments
ack01130  Biosynthesis of antibiotics
ack01200  Carbon metabolism
Module
ack_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ack_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ack_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C380_16925
   00650 Butanoate metabolism
    C380_16925
  Energy metabolism
   00190 Oxidative phosphorylation
    C380_16925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C CybS
Motif
Other DBs
NCBI-ProteinID: AFU47080
UniProt: K0I3I8
Position
3684070..3684435
Genome map
AA seq 121 aa AA seqDB search
MSVNYGSKRVVVGAHYGLRDWLSQRVTAVLMALFTLALLAQVIFSKGPIGYDKWAGIFSA
QWMKVLTFSVIVAIAWHAWVGLREVLMDYIKPVGLRLALQVFSIVWLVSCAGWGIQVLWR
L
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcaattacggttccaagcgcgtcgtcgtcggcgcccactatggtctgcgcgac
tggctcagccagcgcgtcacggcagtcctgatggcgctgttcaccctggcgctgctggcc
caggtcatcttttccaaaggccccatcggctacgacaaatgggcgggcatcttctcggcc
cagtggatgaaggtgctgaccttctccgtgatcgtcgcgatcgcctggcatgcgtgggtc
ggcctgcgcgaagtcctgatggactacatcaagcccgtgggcctgcgcctggcactgcaa
gtgttcagcatcgtctggctggtcagctgcgccggctggggcatccaggttctgtggcgt
ctctga

DBGET integrated database retrieval system