KEGG   Acidovorax sp. KKS102: C380_18345Help
Entry
C380_18345        CDS       T02290                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ack  Acidovorax sp. KKS102
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C380_18345
Enzymes [BR:ack01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     C380_18345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3987124..3987951
Genome map
AA seq 275 aa AA seqDB search
MGTSAPRVIVTRPAREAAHWVTQLGAHGIQAVALPLIAIGPCTDTAMQQALDTARANVDT
YRALMFVSGNAVVHFFEQKRPVALDIHALTATKTRAWAPGPGTARALEQAGVPRSAIDGP
APDAPQFDSEALWQQVARQVQPGDRVLIVRGRSATPQGAHESPQGNGREWLAQQIAARGG
QVEFVVAYQRGAPRFTAQEVALAQQAAQDGSVWLLSSSEAVAHLPEALPGQQWGAAHALA
THPRIAEAARAAGFGTVRECRPALEDVVASIESAA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgggcacctcagcgccccgggtcatcgtcacacgccccgcccgcgaagcggcgcactgg
gtcacgcaactgggcgcacacggcatacaggctgtggcgctgcccctgattgcgattggt
ccctgcacggacaccgccatgcagcaggcgctggacacggcccgcgccaacgtcgacacc
taccgtgccctgatgtttgtgagcggcaatgccgtggtgcacttttttgagcaaaaacgc
cctgtagcgctagatattcatgccctgacagctacaaaaacaagagcatgggcacccggc
ccgggcacagcccgcgcgctggagcaggcgggcgtaccgcgcagcgccatcgacgggcct
gcgcccgacgcaccccagttcgactcggaggcactatggcagcaggtggcccgccaggtg
cagcccggcgaccgcgtgctgatcgtgcgcggccgatccgccacaccccagggcgcacac
gaatcgccccaaggcaacggccgcgagtggctggcccagcagatcgcggcgcggggtggc
caggtggagtttgtggtggcctaccaacgcggcgccccccgcttcacggcgcaagaggtg
gcgctggcgcaacaggcagcccaagatggctccgtctggctgctgagcagctccgaggcg
gtggcccacctgcccgaggccctgccgggccagcaatggggcgccgcccatgcgctggcc
acccacccgcgcatcgccgaagcggcccgcgcagcgggctttggcaccgtgcgggaatgc
cgtccggcgctggaagacgtggtggcctcgatagaatcggccgcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system