KEGG   Acidovorax sp. KKS102: C380_18535Help
Entry
C380_18535        CDS       T02290                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ack  Acidovorax sp. KKS102
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    C380_18535
Enzymes [BR:ack01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     C380_18535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4029453..4029980)
Genome map
AA seq 175 aa AA seqDB search
MSLRDVGAQPTLVYVGLGANLGEREAALRKALATLGQYPGTRVLRVSPLYGSAPVDAGGP
DYLNAVAEVATTLTPEALLQALQAIEQSAGRERPYRNAPRTLDLDILWFGDQVIDTPTLT
VPHPRMAERAFVLRPLADLVPERLAAEALQAVTTQSIYPLADGRWAEGVVGGACS
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
gtgagtctgcgggacgtgggcgcacagcccaccctggtctacgtcggcctgggcgccaac
ctgggcgagcgcgaagccgccctgcgcaaggccctggctaccctgggccaatacccaggc
acccgcgtgctgcgggtgtcgccgctctatggcagcgcacccgtggatgccggtgggcct
gactacctgaacgccgtggccgaagtggccaccaccctcacccccgaggccctgctgcag
gcgctgcaggccatcgaacagtccgccgggcgcgagcgcccctaccgcaatgcaccccgc
acgctggacctggacatcctgtggtttggcgaccaggtgatcgacacccccaccctcacc
gtgccccacccccgcatggccgaacgcgcgtttgtactgcgtcctttggccgatctggtg
ccggagcgcctggcagcggaagccctgcaggcggtgaccacgcagagcatctacccgctg
gccgacgggcgctgggccgagggtgtggtgggtggtgcttgctcctga

DBGET integrated database retrieval system