KEGG   Acidovorax sp. KKS102: C380_19755Help
Entry
C380_19755        CDS       T02290                                 

Definition
disulfide bond isomerase DsbC/G
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ack  Acidovorax sp. KKS102
Brite
Enzymes [BR:ack01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     C380_19755
Secretion system [BR:ack02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   C380_19755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4294870..4295598
Genome map
AA seq 242 aa AA seqDB search
MKLTTALLTAAAATLSLSATAQEDAIRKALAQRIPQMDKIDEVRPTPMKGLYEVRIGTDL
FYTDAKGDYVIQGELIDSKARRNLTEDRINKLTAVNFSALPLKDAVTIVRGDGKRKVAVF
EDPNCGYCKRFERDLQQINNVTVYLFLYPILSPDSAEKSRNIWCSKDQATAWQDQMVRDK
PAPAASCDTSALQRNLAFGKKYKITGTPTLIFANGTRVPGAIGAQEVEKRLAEAASDTPS
AN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaccactgctttgctgaccgccgcggcagccaccctgagcctgagcgccacg
gcgcaagaggacgccatccgcaaggcattggcccagcgtattcctcagatggacaagatc
gacgaagtgcgcccaactcccatgaaaggtctgtacgaagtgcgcatcggcaccgacctg
ttctacaccgacgcgaagggcgactatgtgatccagggcgaactcatcgactccaaggcg
cgccgcaacctgaccgaagaccgcatcaacaagctgacagcggtcaacttctccgccctg
cccctgaaagatgccgtgaccattgtgcgcggcgacggcaagcgcaaggtggccgtgttc
gaggaccccaactgtgggtactgcaaacgctttgagcgcgacctgcagcaaatcaacaac
gtgacggtgtacctcttcctgtaccccatcctgagcccggattcggccgaaaagtcgcgc
aacatctggtgttccaaggaccaggccacggcatggcaagaccagatggtgcgtgacaag
cccgcaccggccgccagctgcgacacgagtgctctgcagcgcaacctggcctttggcaag
aagtacaaaatcaccggcacccccaccctgatttttgccaacggcacacgcgtgcccggc
gccatcggtgcccaggaggtggaaaagcgcctggccgaagccgccagcgacaccccctcc
gccaattga

DBGET integrated database retrieval system