KEGG   Acidovorax sp. KKS102: C380_21070Help
Entry
C380_21070        CDS       T02290                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ack  Acidovorax sp. KKS102
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C380_21070
Enzymes [BR:ack01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     C380_21070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4593516..4594460
Genome map
AA seq 314 aa AA seqDB search
MSTIHTPRIAVVGSLNMDLVLQVQHAPGPGETVLADALHLVPGGKGGNQAVACARQGAQV
ALFGRVGDDGYGHTLRAGLDADGIDHSGVQTDTATTTGVAAITVEATGQNRIVVVPGANG
RFVLDAAALGNALQGAGGLVLQFETPLPQVLAAAEMAHAAGCPVVLNPSPIQPLPEALWP
RVHTLVVNEVEAAALAGQNVTTPADAAQAAQALRAKGPAQVVVTLGAAGAVAADAAGNRY
HPGLVVKAVDTTAAGDTFLGALAVALARGEPLDAAVREGIRASALCVTQPGAQPSIPTRA
AVAHSPQPPAWSPL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccatccacacaccccgcatcgccgtcgtcggcagcctgaacatggacctggtg
ctgcaggtacagcacgcaccgggccctggcgaaaccgtgttggccgacgccctgcacctg
gtgcccggcggcaaaggcggcaaccaggccgtggcctgcgcgcgccagggcgcccaggtg
gccttgttcggccgcgtgggcgacgacggctacggccacaccctgcgcgccgggctcgat
gccgacggcattgaccacagcggcgtgcagaccgacaccgcaaccaccaccggcgtagcc
gccatcacggtggaagcgacagggcagaaccgtatcgtggtcgtgcccggcgccaatggc
cgctttgtgctggatgccgccgcgctgggcaacgcgctgcaaggcgcaggcggcctggtg
ctgcagtttgaaacgcccctgccccaggtgctggccgccgccgagatggcgcatgccgct
ggctgccccgtggtgctcaacccctcgcccatccagcccctgcccgaggccctgtggccg
cgggttcacacgctggtcgtgaacgaggtggaagccgctgcgctggcgggccagaacgtg
accacgcccgccgatgccgcgcaggccgcacaagccctgcgcgccaagggccccgcccag
gtggtggtgaccctgggcgcggcaggcgccgtagccgccgacgccgcaggcaaccgctac
cacccgggcctcgtcgtgaaagccgtggacaccacggccgctggtgacaccttcctgggc
gcgctggccgtagccctggcacgcggcgaaccactggacgccgccgtgcgcgaaggcatc
cgcgcatcggcgctgtgcgtcacccagcccggcgcccagccctccatccccacccgcgcc
gccgtggcgcacagcccccaaccgcccgcctggagccccctgtga

DBGET integrated database retrieval system