KEGG   Acidovorax sp. KKS102: C380_21610Help
Entry
C380_21610        CDS       T02290                                 

Definition
phospholipase A1
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
ack  Acidovorax sp. KKS102
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    C380_21610
   00565 Ether lipid metabolism
    C380_21610
   00590 Arachidonic acid metabolism
    C380_21610
   00591 Linoleic acid metabolism
    C380_21610
   00592 alpha-Linolenic acid metabolism
    C380_21610
Enzymes [BR:ack01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     C380_21610
    3.1.1.32  phospholipase A1
     C380_21610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4707832..4709067
Genome map
AA seq 411 aa AA seqDB search
MSAITHVPAAPHRHRSLALLLAVALAPAGAALAQSAPAAATGAATGTDAALRRCTALSSD
NQARLACFDAWAAEQAQAAPAGGQAWQAPAASANASGVTSSSAVPPPVDATLPATRIIDV
ARTEGCRDPQYSDLSRFWELETGTDCGTFSFRGYRPITVSVVASSSVNRQPTSDADGNSA
TDSTPYRRTENRIQLSVRTKIAQGMLTQGHPTLKDSLWFGYTQQSYWQLFTPEISRPFRA
TDHEPELMYVYPTTAQLPFGWKWRYSGIGLVHQSNGQSKPLSRSWNRAYLMTGIELDNRF
SVNARIWKRIPESAGSDDNPGISDYIGRGELSLLWNVNKDNTLGATVRHTLASSDRGSVR
VEWLQALGTGLFGSKSNLRLHTSLFSGYGDSMIDYNRKRTVFSVGLSLVDF
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccataacgcacgtgcccgctgcgccccatcggcaccgctctctggccctgctg
ctggcggtcgccctggccccggccggcgcggcactggcgcaatcagccccagccgcagcc
accggcgccgcaacagggaccgacgcagccttgcgccgctgcaccgctctgtccagcgac
aaccaggcgcgcctggcctgctttgatgcctgggcggccgagcaggcgcaggcggctcct
gcgggtgggcaggcgtggcaagcccccgcggcatcagccaacgccagcggagtaacgtct
tcgtcggccgtgccaccaccggtggacgccacgctgcccgccacgcgcatcatcgacgtg
gcgcgcactgaaggctgccgcgacccacagtacagcgacctctcccgcttctgggagctg
gagacgggcaccgactgcggcacgttcagcttccgcggctaccgcccgatcacggtgtcg
gtggtggcatcgagcagcgtgaaccgccagcccacgtcggatgccgacggcaactcggcc
accgactccacgccgtaccgccgcactgaaaaccgcatccagctgtccgtgcgtaccaag
atcgcccagggcatgctgacccagggccaccccacgctcaaggattcgctgtggtttggc
tacacacagcagtcgtactggcagctgttcacgcccgagatctcgcgccccttccgcgcc
acggaccacgagcccgagctgatgtacgtgtaccccaccacggcgcagctgccgtttggc
tggaagtggcgctacagcggcatcggcctggtgcaccagtccaacggccagagcaaaccc
ctgtcgcgcagctggaaccgcgcgtacctgatgaccggcatcgagttggacaaccgcttc
agcgtgaacgcccgtatctggaagcgcatccccgaaagcgcgggcagcgacgacaacccg
ggcatcagcgactacatcggccggggcgagctgtcgctgctgtggaacgtgaacaaggac
aacaccctgggcgccaccgtgcgccacacgctggccagcagcgaccggggctcggtgcgc
gtggagtggctacaggccctgggcaccggcctgtttggcagcaagagcaacctgcgcctg
cacacctcgctgttcagcggctatggcgacagcatgatcgactacaaccgcaagcgcact
gtgttcagcgtggggttgagtctggtggacttctag

DBGET integrated database retrieval system