KEGG   Acidovorax sp. KKS102: C380_21795Help
Entry
C380_21795        CDS       T02290                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ack  Acidovorax sp. KKS102
Pathway
ack00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    C380_21795
Enzymes [BR:ack01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     C380_21795
Transporters [BR:ack02000]
 Other Transporters
  Pores ion channels [TC:1]
   C380_21795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_C_2 GST_N_2 GST_N GST_C_3 GST_C_5 GST_C Tom37
Motif
Other DBs
NCBI-ProteinID: AFU48051
UniProt: K0IFE3
Position
4744892..4745539
Genome map
AA seq 215 aa AA seqDB search
MLTLCGFSASNYYNKVKLALLEKGLPFTEELAWVGETDRSASPLGKVPYLRTPQGPLCES
AVMADYIEAAHPEHPLIPADPYQAAKVRELITFLELHLELVARNLYPQAFFGGTVSETAK
EKVGAQLQKNIAAFGQLAQFSPYVGGDTFTMADCAAIVHLPLVSSATKIIYGKDYLADLP
VRDYLARMAERPHVQRVNVDRKTNTAEMLARPPKR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgctcacactctgcggcttttcggccagcaactactacaacaaggtcaagctggccctg
ctcgaaaagggcctgccgttcaccgaagagctggcctgggtgggcgaaaccgaccgcagc
gccagcccgctgggcaaggtgccctacctgcgcacgccgcagggaccgctgtgtgagtct
gccgtgatggccgactacatcgaagccgcccatcccgagcacccgctgatcccggccgac
ccctaccaagccgccaaggtgcgcgagctgatcacattcctggaactgcacctggagctg
gtcgcgcgcaacctgtatccccaggccttctttggcggcaccgtgagcgagacggccaag
gaaaaggtcggcgcacagctgcagaagaacattgccgccttcggccagctggcccagttc
agcccctacgtgggcggcgacaccttcaccatggccgactgcgcggccatcgtgcacctg
ccgctggtcagctcggccaccaagatcatctacggcaaggactacctggccgacctgccc
gtgcgcgactacctggcccgcatggccgagcgcccccatgtgcagcgcgtgaacgtggac
cgcaagaccaacaccgccgaaatgctggcgcgcccgcccaagcgctga

DBGET integrated database retrieval system