KEGG   Acidovorax sp. KKS102: C380_21980Help
Entry
C380_21980        CDS       T02290                                 

Definition
cheb methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ack  Acidovorax sp. KKS102
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ack00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    C380_21980
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    C380_21980
Enzymes [BR:ack01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     C380_21980
Two-component system [BR:ack02022]
 CheA family
  CheA-CheYBV
   C380_21980
Bacterial motility proteins [BR:ack02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    C380_21980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4775513..4776136
Genome map
AA seq 207 aa AA seqDB search
MSSPAHTPRPVPPGGYAAIVVGGSAGGIDALLELLPALPATLQAAVLVVLHLPRDRRSLL
VEIFQPRCALPMREAQDKDAITPGSVSFAPPDYHLLVDAGPQGPHVGLSVDPPLHFSRPS
IDVLFESAADHYGPRLVGILLSGANEDGVHGLQAIQAAGGLTIVQDPASASMPTMPQAAL
AALAVDHILPPEGIARLLADLHQRQQL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagccccgcccacacacccaggccagtgccccccgggggctacgccgccatcgtg
gtgggcggctctgcgggcggtatcgacgccctgctggagctgctgcccgcgctgcccgcc
acactgcaggcggcggtgctggtggtgctgcacctgccccgggaccggcgcagcctgctg
gtggagatttttcagccccgctgcgccctgccgatgcgcgaagcgcaggacaaggacgcc
atcacgccaggatcggtgagttttgcgccaccggactaccacctgctggtcgatgccgga
ccccagggcccgcatgtggggctgtcggtggaccctcccctgcatttttcccgcccctcc
atcgacgtgctgttcgagtcggcggcagaccactacggcccccggctggtgggcatcctg
ctatcaggcgccaacgaagacggcgtgcacggcctgcaagccattcaggcggcgggcggc
ctcaccatcgtgcaagaccctgccagcgccagcatgcccaccatgccgcaggcggccctc
gcggccctggcggtggaccacatcctgccccctgaaggcattgcaaggctgctggcagac
ctgcaccagcgccagcagctttga

DBGET integrated database retrieval system