KEGG   Acidovorax sp. KKS102: C380_22060Help
Entry
C380_22060        CDS       T02290                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ack  Acidovorax sp. KKS102
Pathway
ack00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ack01100  Metabolic pathways
ack01110  Biosynthesis of secondary metabolites
ack01130  Biosynthesis of antibiotics
ack01230  Biosynthesis of amino acids
Module
ack_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C380_22060 (trpC)
Enzymes [BR:ack01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     C380_22060 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AFU48104
UniProt: K0IA13
Position
complement(4793278..4794081)
Genome map
AA seq 267 aa AA seqDB search
MSSDILNKIVAVKHEEVAAAKKRLPFDAMRADAESRVLTRDFEGALRAKIAKGQAAVIAE
VKKASPSKGVLRANFEPADIAQSYMEGDGKVSAACLSVLTDRQFFQGQPDYLKQARASTT
LPVLRKDFMVDAYQIYESRAMGADAVLLIAACLDDAQMADFEAIARSLDMAVLVEVHDRA
ELERALKLKTPLVGINNRNLRTFEVTLDTTLGMLKDVPADRLLVTESGILKPADVKTMRD
AGVHAFLVGEAFMRADDPGLALAKLFA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtgacatcctcaacaagatcgtggccgtcaagcacgaagaagtggccgccgcc
aaaaagcgcctgccctttgacgccatgcgcgccgacgccgagagccgcgtgctcacgcgc
gactttgaaggcgcactgcgcgccaagatcgccaagggccaggccgccgtgattgccgag
gtcaagaaagccagccccagcaagggcgtgctgcgcgccaatttcgagccggccgacatc
gcccagagctacatggaaggcgatggcaaggtcagcgcggcctgcctgtcggtgctgacc
gaccgccagttcttccagggccagcccgactacctgaagcaagcccgcgctagcactacg
ctgcccgtgctgcgcaaggacttcatggtggacgcgtaccagatctatgaatcgcgtgcc
atgggcgccgacgctgtgctgctgatcgccgcctgcctggacgatgcccagatggccgac
tttgaagccatcgcccgcagcctggacatggcggtgctggtggaggtgcacgaccgcgcc
gagctggagcgcgcgctgaagctcaagaccccgctggtcggcatcaacaaccgcaacctg
cgcacgttcgaggtcacgctggacacaacactgggcatgctcaaggatgtgcccgctgac
cgcctgctggtcaccgagtcgggcatcctgaagcctgccgacgtgaagaccatgcgcgac
gcgggcgtgcatgccttcctggtgggcgaggccttcatgcgcgccgacgaccccggcctg
gcgctggccaagctgtttgcttga

DBGET integrated database retrieval system