KEGG   Acidovorax sp. KKS102: C380_22345Help
Entry
C380_22345        CDS       T02290                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ack  Acidovorax sp. KKS102
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ack01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ack00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ack00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4850899..4853109
Genome map
AA seq 736 aa AA seqDB search
MTDRTQVHGLQVATSLYRFVEDKVLPGTGVDAAAFWKGFDAIVADLAPRNIALLAERDRL
QTELDTWHKANPGPIQNMVAYRSFLEKIGYLVPQPADVKATTANVDDELATQAGPQLVVP
ILNARYALNAANARWGSLYDALYGTDAISEEGGAEKGKGYNPVRGAKVIAFARQVLDDTA
PLASGSHKDSTGYKVEGGQLVVSLANGSTTGLKDASQFKGYQGNAASPSSVLLQHNGLHL
DLQIDRSTPIGQSDAAGVSDLVLEAALSTILDLEDSVAAVDAEDKVLGYSNWLGIIQATL
TEQVAKGGKTFTRGLNPDRIYTGPQGGEVRLHGRSLMFLRNVGHLMTNPAILWKDAQGQV
REIPEGIMDAVVTTAIALHDLQGHGANGIRNSRKGSVYIVKPKMHGPAEVGFAAELFGRV
ENLLGLPDSTVKLGIMDEERRTSVNLKACIAAASSRVAFINTGFLDRTGDEMHTAMHAGP
MVRKGDMKTSAWIQSYEKNNVLVGLSCGLRGKAQIGKGMWAMPDLMAEMLKQKIAHPKAG
ANTAWVPSPTGATLHALHYHQVKVSDIQIELEKTDVNAERDNLLTGLLTVPVAASPNWSD
AEKQQELDNNAQGILGYVVRWIDQGVGCSKVPDIHNVGLMEDRATLRISSQHMANWLHHG
VVTEAQVRETFERMAAVVDQQNAGDPLYRPMAGHFDTSMAYQAACDLVFKGLEQPSGYTE
PLLHAWRLKLKAAQAA
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgcacccaagttcacggcctgcaagtggccacctctctgtaccgttttgtc
gaagacaaggtgctgcccggcacgggggtggatgccgccgccttctggaagggctttgac
gccatcgtggccgacctggccccccgcaacatcgccctgctggccgagcgcgaccgcctg
cagaccgagctggacacctggcacaaggccaaccccggccccatccagaacatggtggcc
taccgcagctttctcgaaaagatcggctacctggtgccccagcctgccgacgtgaaggcc
accacggccaacgtggacgatgaactggccacgcaagccggcccgcagctggtggtgcct
atcctgaacgcacgctatgcgctgaacgccgccaacgcgcgctggggcagcctgtatgac
gcgctgtatggcacggatgccatcagcgaagaaggcggcgccgagaagggcaagggctac
aaccccgtgcgcggcgccaaggtgatcgcgtttgcacgccaggtgctggatgacacggcg
cccctggcctcgggctcgcacaaggactcgacgggctacaaggtagaaggcggccagctg
gtggtttcactggccaacggcagcaccacgggcctcaaggacgcatcgcaattcaagggt
taccagggcaatgccgcctcaccgtcgtcggtgctgctgcagcacaacggcctgcacctg
gacctccagatcgaccgcagcactcccatcggccagtctgacgctgctggcgtgagcgac
ctggtgctggaagcagccttgtccaccatcctggacctggaagactccgtggccgccgtg
gatgccgaagacaaggtgctgggctacagcaactggctgggcatcatccaggccacgctg
accgagcaggtcgccaagggcggcaagaccttcacacgcgggctgaaccctgaccgtatc
tacaccggccctcaaggtggcgaagtgcgcctgcatggccgttcgctgatgttcctgcgc
aatgtgggccacctgatgaccaacccggccatcctgtggaaggacgcccagggccaggtg
cgcgagatccccgaaggcatcatggatgcggtggtgaccacggcgattgccctgcacgac
ctgcaaggccacggcgcgaacggcatccgcaacagccgcaagggcagcgtctacatcgtc
aagcccaagatgcacggccccgccgaagtgggctttgccgccgagctgtttggccgcgtc
gagaacctgctgggcctgcccgacagcaccgtcaagctgggcatcatggacgaagagcgc
cgcacgtccgtcaacctcaaggcctgtatcgccgctgcatcgagccgcgtggcgttcatc
aacaccggcttcctggaccgcacgggtgacgaaatgcacaccgccatgcacgccggcccc
atggtgcgcaagggcgacatgaagaccagcgcctggatccagtcgtacgagaagaacaac
gtgctggtgggtctgagctgcggcctgcgcggcaaggcccagatcggcaagggcatgtgg
gccatgcccgacctgatggccgagatgctcaagcagaagatcgcccaccccaaggccggc
gccaacaccgcctgggtgcccagccccacgggcgccacgctgcacgcgctgcactaccac
caggtgaaggtgagcgacatccagatcgagctggaaaaaaccgatgtgaacgccgagcgc
gacaacctgctgaccggtctgctcaccgtgcccgtggccgccagcccgaactggagcgac
gccgaaaagcagcaggagctggacaacaacgcccagggcatcctgggctatgtggtgcgc
tggatcgaccagggcgtgggctgctccaaggtgcccgacatccacaacgtgggcttgatg
gaagaccgcgccacgctgcgcatcagtagccagcacatggccaactggctgcaccacggc
gtggtgaccgaggcgcaggtgcgcgagaccttcgagcgcatggccgcggtggtggaccag
caaaacgcgggggaccccctgtaccgccccatggccggccacttcgataccagcatggcc
taccaagcggcgtgcgacctggtcttcaagggcctggagcagcccagcggctacaccgaa
ccactgctgcacgcctggcgcctgaagctgaaggcagcgcaagcagcctga

DBGET integrated database retrieval system