KEGG   Acidovorax sp. KKS102: C380_22345Help
Entry
C380_22345        CDS       T02290                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
ack  Acidovorax sp. KKS102
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    C380_22345
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    C380_22345
   00630 Glyoxylate and dicarboxylate metabolism
    C380_22345
Enzymes [BR:ack01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     C380_22345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4850899..4853109
Genome map
AA seq 736 aa AA seqDB search
MTDRTQVHGLQVATSLYRFVEDKVLPGTGVDAAAFWKGFDAIVADLAPRNIALLAERDRL
QTELDTWHKANPGPIQNMVAYRSFLEKIGYLVPQPADVKATTANVDDELATQAGPQLVVP
ILNARYALNAANARWGSLYDALYGTDAISEEGGAEKGKGYNPVRGAKVIAFARQVLDDTA
PLASGSHKDSTGYKVEGGQLVVSLANGSTTGLKDASQFKGYQGNAASPSSVLLQHNGLHL
DLQIDRSTPIGQSDAAGVSDLVLEAALSTILDLEDSVAAVDAEDKVLGYSNWLGIIQATL
TEQVAKGGKTFTRGLNPDRIYTGPQGGEVRLHGRSLMFLRNVGHLMTNPAILWKDAQGQV
REIPEGIMDAVVTTAIALHDLQGHGANGIRNSRKGSVYIVKPKMHGPAEVGFAAELFGRV
ENLLGLPDSTVKLGIMDEERRTSVNLKACIAAASSRVAFINTGFLDRTGDEMHTAMHAGP
MVRKGDMKTSAWIQSYEKNNVLVGLSCGLRGKAQIGKGMWAMPDLMAEMLKQKIAHPKAG
ANTAWVPSPTGATLHALHYHQVKVSDIQIELEKTDVNAERDNLLTGLLTVPVAASPNWSD
AEKQQELDNNAQGILGYVVRWIDQGVGCSKVPDIHNVGLMEDRATLRISSQHMANWLHHG
VVTEAQVRETFERMAAVVDQQNAGDPLYRPMAGHFDTSMAYQAACDLVFKGLEQPSGYTE
PLLHAWRLKLKAAQAA
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgcacccaagttcacggcctgcaagtggccacctctctgtaccgttttgtc
gaagacaaggtgctgcccggcacgggggtggatgccgccgccttctggaagggctttgac
gccatcgtggccgacctggccccccgcaacatcgccctgctggccgagcgcgaccgcctg
cagaccgagctggacacctggcacaaggccaaccccggccccatccagaacatggtggcc
taccgcagctttctcgaaaagatcggctacctggtgccccagcctgccgacgtgaaggcc
accacggccaacgtggacgatgaactggccacgcaagccggcccgcagctggtggtgcct
atcctgaacgcacgctatgcgctgaacgccgccaacgcgcgctggggcagcctgtatgac
gcgctgtatggcacggatgccatcagcgaagaaggcggcgccgagaagggcaagggctac
aaccccgtgcgcggcgccaaggtgatcgcgtttgcacgccaggtgctggatgacacggcg
cccctggcctcgggctcgcacaaggactcgacgggctacaaggtagaaggcggccagctg
gtggtttcactggccaacggcagcaccacgggcctcaaggacgcatcgcaattcaagggt
taccagggcaatgccgcctcaccgtcgtcggtgctgctgcagcacaacggcctgcacctg
gacctccagatcgaccgcagcactcccatcggccagtctgacgctgctggcgtgagcgac
ctggtgctggaagcagccttgtccaccatcctggacctggaagactccgtggccgccgtg
gatgccgaagacaaggtgctgggctacagcaactggctgggcatcatccaggccacgctg
accgagcaggtcgccaagggcggcaagaccttcacacgcgggctgaaccctgaccgtatc
tacaccggccctcaaggtggcgaagtgcgcctgcatggccgttcgctgatgttcctgcgc
aatgtgggccacctgatgaccaacccggccatcctgtggaaggacgcccagggccaggtg
cgcgagatccccgaaggcatcatggatgcggtggtgaccacggcgattgccctgcacgac
ctgcaaggccacggcgcgaacggcatccgcaacagccgcaagggcagcgtctacatcgtc
aagcccaagatgcacggccccgccgaagtgggctttgccgccgagctgtttggccgcgtc
gagaacctgctgggcctgcccgacagcaccgtcaagctgggcatcatggacgaagagcgc
cgcacgtccgtcaacctcaaggcctgtatcgccgctgcatcgagccgcgtggcgttcatc
aacaccggcttcctggaccgcacgggtgacgaaatgcacaccgccatgcacgccggcccc
atggtgcgcaagggcgacatgaagaccagcgcctggatccagtcgtacgagaagaacaac
gtgctggtgggtctgagctgcggcctgcgcggcaaggcccagatcggcaagggcatgtgg
gccatgcccgacctgatggccgagatgctcaagcagaagatcgcccaccccaaggccggc
gccaacaccgcctgggtgcccagccccacgggcgccacgctgcacgcgctgcactaccac
caggtgaaggtgagcgacatccagatcgagctggaaaaaaccgatgtgaacgccgagcgc
gacaacctgctgaccggtctgctcaccgtgcccgtggccgccagcccgaactggagcgac
gccgaaaagcagcaggagctggacaacaacgcccagggcatcctgggctatgtggtgcgc
tggatcgaccagggcgtgggctgctccaaggtgcccgacatccacaacgtgggcttgatg
gaagaccgcgccacgctgcgcatcagtagccagcacatggccaactggctgcaccacggc
gtggtgaccgaggcgcaggtgcgcgagaccttcgagcgcatggccgcggtggtggaccag
caaaacgcgggggaccccctgtaccgccccatggccggccacttcgataccagcatggcc
taccaagcggcgtgcgacctggtcttcaagggcctggagcagcccagcggctacaccgaa
ccactgctgcacgcctggcgcctgaagctgaaggcagcgcaagcagcctga

DBGET integrated database retrieval system