KEGG   Acidovorax sp. KKS102: C380_22420Help
Entry
C380_22420        CDS       T02290                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ack  Acidovorax sp. KKS102
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    C380_22420
  Amino acid metabolism
   00330 Arginine and proline metabolism
    C380_22420
Enzymes [BR:ack01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     C380_22420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4875923..4876900
Genome map
AA seq 325 aa AA seqDB search
MPPTALRSAQPTSLIGAPTDIGAGARGASMGPEALRVAGLQAALESHGLQVFDRGNLSGP
ANPWQPPMDGYRHLPEVVEWNQRVFDAVYAELQLGHLPILLGGDHCLGLGSISAVARHCA
EVGKKLRVLWLDAHADFNTSALTPSGNVHGMPVACLCGFGPEALTGLARMPGGGPALHPS
QIRQIGIRSVDAGEKRFVHEQGLEVFDMRYIDEVGMRQTMQQALAGLDAHTHLHVSFDVD
FLDPDIAPGVGTTVPGGPTYREAQLCMEMIADSGRLASLDIVELNPALDVRNRTAVLAVD
LVESLFGKSTLMRVPSHGQGPTLSA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaccgccctgcgcagcgcccagcccaccagcctgatcggcgcccctaccgac
atcggcgcaggtgcacgtggcgcctccatggggcccgaggccttgcgtgtggcgggcctg
caggcagcgctggagtcccacgggctgcaggtgtttgacaggggcaacctgagcggtccg
gccaacccgtggcagccgccgatggacggctaccgccacctgcccgaggtggtggagtgg
aaccagcgcgtgttcgacgcggtgtatgccgagctgcagctgggccacctgcccattctg
ctggggggtgaccactgcctgggcctgggcagcatcagcgccgtggcccgccattgcgcg
gaggtgggcaagaagctgcgggtgctatggctggatgcccacgccgacttcaataccagt
gccctgacgcccagcggcaatgtgcatggcatgcccgtggcctgcctgtgcgggtttggc
cctgaagcactgaccgggctggcccgcatgccgggcggtggcccggcgctgcacccgtca
cagatccggcagattggcatccgcagcgtggacgcaggcgaaaagcgctttgtgcacgag
cagggcctggaggtgttcgacatgcgctacatcgacgaggtgggcatgcgccagaccatg
cagcaggcgctggccggattggatgcacacacccacctgcatgtgagctttgatgtggat
tttctggaccccgacattgcccctggcgtgggcaccacggtgcccggcggccccacctac
cgcgaggcacagctgtgcatggagatgattgccgacagcgggcgcctggcctcgctggac
attgtggagctcaaccccgcgctggatgtgcgcaaccgcactgccgtgctggcggtggac
ctggtggagtcgctgtttggcaagagcacgctgatgcgcgtgccctcgcacggccaggga
ccgacgctgagcgcctga

DBGET integrated database retrieval system