KEGG   Acidovorax sp. KKS102: C380_22420Help
Entry
C380_22420        CDS       T02290                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
ack  Acidovorax sp. KKS102
Pathway
ack00220  Arginine biosynthesis
ack00330  Arginine and proline metabolism
ack01100  Metabolic pathways
ack01110  Biosynthesis of secondary metabolites
ack01130  Biosynthesis of antibiotics
ack01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    C380_22420
   00330 Arginine and proline metabolism
    C380_22420
Enzymes [BR:ack01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     C380_22420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AFU48176
UniProt: K0IFN3
Position
4875923..4876900
Genome map
AA seq 325 aa AA seqDB search
MPPTALRSAQPTSLIGAPTDIGAGARGASMGPEALRVAGLQAALESHGLQVFDRGNLSGP
ANPWQPPMDGYRHLPEVVEWNQRVFDAVYAELQLGHLPILLGGDHCLGLGSISAVARHCA
EVGKKLRVLWLDAHADFNTSALTPSGNVHGMPVACLCGFGPEALTGLARMPGGGPALHPS
QIRQIGIRSVDAGEKRFVHEQGLEVFDMRYIDEVGMRQTMQQALAGLDAHTHLHVSFDVD
FLDPDIAPGVGTTVPGGPTYREAQLCMEMIADSGRLASLDIVELNPALDVRNRTAVLAVD
LVESLFGKSTLMRVPSHGQGPTLSA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaccgccctgcgcagcgcccagcccaccagcctgatcggcgcccctaccgac
atcggcgcaggtgcacgtggcgcctccatggggcccgaggccttgcgtgtggcgggcctg
caggcagcgctggagtcccacgggctgcaggtgtttgacaggggcaacctgagcggtccg
gccaacccgtggcagccgccgatggacggctaccgccacctgcccgaggtggtggagtgg
aaccagcgcgtgttcgacgcggtgtatgccgagctgcagctgggccacctgcccattctg
ctggggggtgaccactgcctgggcctgggcagcatcagcgccgtggcccgccattgcgcg
gaggtgggcaagaagctgcgggtgctatggctggatgcccacgccgacttcaataccagt
gccctgacgcccagcggcaatgtgcatggcatgcccgtggcctgcctgtgcgggtttggc
cctgaagcactgaccgggctggcccgcatgccgggcggtggcccggcgctgcacccgtca
cagatccggcagattggcatccgcagcgtggacgcaggcgaaaagcgctttgtgcacgag
cagggcctggaggtgttcgacatgcgctacatcgacgaggtgggcatgcgccagaccatg
cagcaggcgctggccggattggatgcacacacccacctgcatgtgagctttgatgtggat
tttctggaccccgacattgcccctggcgtgggcaccacggtgcccggcggccccacctac
cgcgaggcacagctgtgcatggagatgattgccgacagcgggcgcctggcctcgctggac
attgtggagctcaaccccgcgctggatgtgcgcaaccgcactgccgtgctggcggtggac
ctggtggagtcgctgtttggcaagagcacgctgatgcgcgtgccctcgcacggccaggga
ccgacgctgagcgcctga

DBGET integrated database retrieval system