KEGG   Acidovorax sp. KKS102: C380_23305Help
Entry
C380_23305        CDS       T02290                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ack  Acidovorax sp. KKS102
Pathway
ack00020  Citrate cycle (TCA cycle)
ack00640  Propanoate metabolism
ack00660  C5-Branched dibasic acid metabolism
ack01100  Metabolic pathways
ack01110  Biosynthesis of secondary metabolites
ack01120  Microbial metabolism in diverse environments
ack01130  Biosynthesis of antibiotics
ack01200  Carbon metabolism
Module
ack_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ack_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ack00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C380_23305 (sucC)
   00640 Propanoate metabolism
    C380_23305 (sucC)
   00660 C5-Branched dibasic acid metabolism
    C380_23305 (sucC)
Enzymes [BR:ack01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     C380_23305 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AFU48353
UniProt: K0HYU7
Position
complement(5063053..5064213)
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQGKEILRNFGVPVPRGIPAFTVQEAVEAAQKLGGPVWVVKAQIHAGGRGKGGGV
KVAKTIDDVKARASEILGMQLVTHQTGPEGQKVRRLYIEDGADIKNELYVSLVTDRATQK
VALIASSEGGMDIEEVAHSTPEKIVTEMIDPLTGITEAQSRKVAAAIGLTGASIDQAVDI
FAKIYKCYMDTDASLVEINPLNCDSKGNLMALDAKFNFDANALFRHPEIVAFRDLDEEDP
AEVEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATPEKVTE
AFKIMLKNPKVKGILVNIFGGIMKCDTIATGVITACKAVNLNVPLVVRMKGTNEELGKKM
LAESGLPIIAADTMAEAATKIVAAVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgaataccaaggcaaggaaatcttgcgcaattttggtgtgcccgttccg
cgtggcattcccgcattcacggtgcaagaagccgtggaagcagcccagaagctcggcggc
cccgtgtgggtggtcaaggcccagatccacgccggtggccgtggcaagggcggcggcgtg
aaggttgccaagaccattgacgacgtgaaggctcgcgccagcgaaatcctgggcatgcaa
ctggtcacgcaccagaccggccctgaaggccagaaggtccgccgcctgtacatcgaagac
ggcgccgacatcaagaacgaactgtacgtttcgctggtcaccgaccgcgccacgcagaag
gtcgccctgatcgcttcgagcgaaggcggcatggacattgaggaagtggcccactccacg
cccgagaagatcgtcaccgagatgatcgacccgctgaccggcatcaccgaagcgcagagc
cgcaaggtggcagccgccatcggcctgaccggcgcttccatcgatcaggctgtggacatc
ttcgccaagatctacaagtgctacatggacaccgatgcgtcgctggtggaaatcaacccg
ctgaactgcgactccaagggcaacctgatggccctggacgcgaagttcaactttgacgcc
aacgccctgttccgccaccccgaaatcgtcgccttccgcgatctggacgaagaagatccc
gccgaagtggaagcctccaagttcgacctggcctacatcagcctggacggcaacatcggc
tgcctggtgaacggcgctggcctggccatggccaccatggacaccatcaagctgttcggc
ggcgagcccgccaacttcctggacgtgggcggcggcgccacccccgagaaggtgaccgaa
gccttcaagatcatgctcaaaaaccccaaggtcaagggcattctggtcaacatcttcggc
ggcatcatgaagtgcgacaccatcgccaccggcgtgatcaccgcctgcaaggccgtgaac
ctgaacgtgccgctggtcgtgcgcatgaagggtacgaacgaagagctgggcaagaagatg
ctggccgagtccggcctgcccatcatcgctgcagacaccatggccgaagctgcgaccaag
atcgttgctgccgtcaagtaa

DBGET integrated database retrieval system