KEGG   Acholeplasma laidlawii: ACL_0177Help
Entry
ACL_0177          CDS       T00659                                 

Definition
bifunctional aldehyde/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
acl  Acholeplasma laidlawii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:acl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ACL_0177
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACL_0177
   00620 Pyruvate metabolism
    ACL_0177
   00650 Butanoate metabolism
    ACL_0177
  Lipid metabolism
   00071 Fatty acid degradation
    ACL_0177
  Amino acid metabolism
   00350 Tyrosine metabolism
    ACL_0177
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ACL_0177
   00626 Naphthalene degradation
    ACL_0177
Enzymes [BR:acl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ACL_0177
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ACL_0177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
165156..167744
Genome map
AA seq 862 aa AA seqDB search
MEKDTLILNEVDLLVTSALEALDEYMEFTQEKIDEIVAKVSVEAIDAHGRLAKLAVEETK
RGVFEDKATKNLFSVEYVINHMRHLKTVGIISENTVTGITEVADPVGVICAITPVTNPTS
TTIFKSLIALKTRNPIVFAFHPNAQNSSKEAARIIKEAAIKSGAPKNCISWIEHPSLDNT
NKLMNHPGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYIEKTANIKTAINDIVMSK
SFDNGMVCASEQAAIIDKEIYKEALAEFKKLHTFLCNKEQKQMLETFMFPDGVKLNPYVV
GKSAHHIAELAGFEVPLNTNILLVECKSVGKEEPLTREKLSPVLAILKSNDEVHGVALAK
SMVELDGLGHSAVIHTQNDELKKTFGLALKAIRIIVNSPATFGGIGNVYNRFIPSLTLGC
GSYGKNSVSDNVSAIHLLNIKRIGERKNNMQWFKVPSKIYFEKDSIEYLRQMRDVNKVVI
ITDRVMVDLGYVKKVTDQLSLRRNHVVYQLFTDVEADPSIETVHKGYELMKSFQPDTIIA
IGGGSPMDAAKAMWLFYENPEVDFNDLKQKFMDIRKRAFRYPDLGRKSKLVCIPTTSGTG
SEVTPFAVITDNKESKKYPLADYSLTPTVAIIDPALTLTQPKSVTADTGMDVLTHAVEAY
VSVLANDYTDSLAIQAVKMVFKYLKRAFDNGLDFEAREKMHNASTMAGMAFGNAFLGISH
SMAHKVGGRYHIPHGRINAILLPHVVLYNGTVPAKLSTWPKYTYYVADEKYMELARAIGL
DPKSKEEGVKMFAKACHDLAVSLGINMSFASQKVEEKDFLEHSETLAYLAYEDQCSTANP
RLPLVADMKVILENAYYGKLDI
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagacacacttatcttaaacgaggtagatcttttagtcacgtctgctttagaa
gcacttgacgaatacatggagtttacccaagagaagattgatgagattgtagccaaagtt
tctgttgaagcaattgatgcacatggccgtttagccaagcttgctgtagaggaaactaaa
cgaggggtatttgaagataaagcaaccaagaatttattttcagtagaatatgtcatcaat
catatgagacacctaaaaactgtagggattatctcggaaaatacagtaacgggtattaca
gaggtagctgatcctgttggggtaatttgcgctattacaccagtaacgaatccaacatcg
acgacaatatttaagtcattgattgcacttaaaactagaaatccaatcgtctttgcgttt
catccaaatgcgcaaaattcatcaaaggaagcggctagaattattaaagaagcagcgatt
aaatcaggtgctccaaaaaattgtatttcatggattgaacatccaagtttagataataca
aataaacttatgaaccacccggggattgcaactattttagcaactggtggtaatgcaatg
gttaaggcagcttactcatgtggtaaaccagctcttggtgtcggtgcaggtaacgtacca
gcatacattgaaaaaactgcaaacattaaaaccgcaatcaatgatattgttatgtctaag
tcatttgataatggtatggtatgtgcatctgaacaagcagctattattgataaagaaatc
tataaagaagctttggcggaatttaaaaagttacatacttttttatgtaacaaagaacaa
aaacaaatgctggaaacatttatgttcccagatggtgtcaagcttaatccttatgttgta
ggtaagagtgcacatcacattgcagaacttgcaggtttcgaagttcctttaaataccaac
attttactagtagaatgtaaaagtgttggtaaagaagaaccacttacaagagaaaaactc
tcgccagtattagcaattcttaaatcaaatgatgaagtacatggtgtagcacttgcaaaa
agtatggtagaacttgatggtttaggacactctgcagtgattcacacacaaaatgatgaa
cttaaaaaaacctttggtttagcacttaaagcgatacgtattatagtgaattcaccagcg
acttttggtggcataggtaatgtatataacaggtttataccatcacttaccttagggtgt
ggttcttatggtaaaaactctgtttctgataatgtcagtgccatccacttacttaatatc
aaacgtatcggtgaaaggaaaaataatatgcaatggtttaaggttccatctaaaatttac
tttgaaaaagattctattgaatacttaagacaaatgagagatgttaacaaggttgtcatc
atcacagatagagtgatggttgacttaggttatgttaaaaaagtaactgatcaactaagt
ttaagacgtaatcatgttgtatatcaactatttaccgatgttgaagctgatccatccatt
gaaacagttcataaaggttatgaactgatgaaatccttccaaccagatacgattatagct
attggtggtggttcaccaatggatgctgcaaaagctatgtggttattctatgaaaaccct
gaagtagattttaacgacttaaaacaaaaattcatggatattagaaaacgtgcatttaga
tatcctgatttaggtagaaaatctaaattagtatgtattccaacaacctcaggtactggt
agtgaagtgactccgtttgcagttatcactgataataaagagtctaaaaaatatccatta
gcagattattcattaacaccaactgtagctattattgaccctgcacttacacttactcaa
ccaaaatctgttacagcagatactggaatggacgtgttaacacatgcagtagaagcttac
gtttcagtacttgctaatgactatacagactcacttgcaattcaagcagttaaaatggta
tttaaatacttaaaacgtgcatttgataatggattggactttgaagcaagagaaaagatg
cataatgcatctaccatggcaggtatggcatttggtaatgcattcttgggtatatctcac
tctatggctcataaagtaggtggaagatatcatatacctcatggtagaattaatgcaatc
ttattaccacatgtcgttttatataatggtacagttccagctaagttatctacttggcca
aaatacacatattatgtagcagatgaaaaatacatggaactagctagagcaatcggatta
gatcctaaatctaaagaagaaggcgttaagatgtttgctaaggcatgtcatgatttagca
gtatcattaggtattaatatgagttttgctagtcaaaaagtagaagaaaaagatttctta
gaacacagtgaaactttagcttatctagcttatgaggatcaatgttcaacagctaaccct
agactacctttagtagcggatatgaaggtgatcctagaaaatgcatattacggcaaacta
gatatatag

DBGET integrated database retrieval system