KEGG   Acholeplasma laidlawii: ACL_0280Help
Entry
ACL_0280          CDS       T00659                                 

Definition
glycoside hydrolase family 3 protein (EC:3.2.1.-)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
acl  Acholeplasma laidlawii
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ACL_0280
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    ACL_0280
Enzymes [BR:acl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ACL_0280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
292002..293573
Genome map
AA seq 523 aa AA seqDB search
MKKFDINKLTTQEKIGQLIVAGFHGTTVGPEIENLIREYKVGNILLFSRNIESAAQLFKL
NQDLQKIAMETFGIPLYITIDQEGGMVTRIFEDGTFFPGAMTIAATNNVEYAYKIGDLMG
KELIDLGINMDLAPVLDVNNNPKNPVIGVRSFSDDPDKVALFGNANIRGLQNHVVATAKH
FPGHGDTHVDSHLALPKVEKPLNELEKFEFKPFKAAINDGLHAIMSAHINFTHLTEDGLP
VTLSKRALTGLLREEMGFEGLIITDGIEMKAIHDNYGTIEATLKTVNAGANLVCICHDLP
YQIGASDRFNKALETGELTMDTLNERVARILTYKEKLNVDLTRTYEDVKENVESIESKAF
ARQVVEEAVTLIKGETFKQHGKTLVISTNPQATSIADEDSHNSKLGRRIREAFANFEVIE
TKVKPTEVEIADIVSIASAFDQIVYTSYNGNVYQTQIQLIDALSALNKDLHVLALRNPYD
LYYTKNIKNYVAFYEYTPNSIEAVVKYLKGQLKPQGVSPIRYE
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttgacattaataaattaacaacccaagaaaaaattggacaattaatcgtt
gcaggcttccatggtacaactgttggaccagaaattgaaaatttaattagagaatataaa
gtaggtaacatcctattattctcaagaaatattgagtctgcagcacaattatttaaatta
aatcaagatttacaaaaaatcgcgatggaaacatttggtattcctttatatattactatc
gatcaagaaggtggtatggttacacgaatttttgaagatggtacattcttccctggtgca
atgacaattgcagcaacaaacaatgttgagtacgcatataaaataggtgacttaatgggt
aaagaattaatcgatcttggtatcaatatggatttagcacctgtacttgatgtgaataat
aaccctaaaaacccagtcattggtgtaagaagtttttcggatgatccagataaagtagct
ttatttggtaatgcaaacattagaggtttacaaaaccacgttgttgcaaccgctaaacac
ttcccaggtcacggtgatacacatgtggactcacacttagcattaccaaaagttgaaaaa
ccattaaatgaattagaaaaatttgaattcaaaccatttaaagcggcaatcaatgatgga
ctacatgcaattatgtcagcacacattaactttacacatctaactgaagatggattacca
gtgacattatctaaacgtgcattaacaggtttactacgtgaagaaatgggctttgaaggt
ttaattattacagatggtatcgaaatgaaagctatccatgataattatggcaccatcgaa
gcgacattaaaaacagtaaacgctggtgcaaacttggtatgtatctgtcatgatttacct
taccaaattggtgcttctgatcgctttaataaagcattagaaacaggtgagttaactatg
gatacactaaatgagcgtgtagcacgtatcttaacatacaaagagaaattaaatgtagac
ttaacacgtacttatgaagatgttaaagaaaatgtagaatctatagaatctaaggctttt
gctagacaagttgtagaagaagcagtgaccttaattaagggtgaaactttcaaacaacat
ggtaaaactttagttatttctacaaaccctcaagcaacttcgattgctgatgaagattca
cataattctaaattaggacgtcgcattagagaagcatttgcaaactttgaagtgattgaa
actaaagttaaaccaactgaagttgaaattgctgacatcgtttcaatagcaagcgcattt
gatcaaatcgtttatacatcatataacggtaatgtctatcaaacacaaatccaattaatt
gatgcattaagcgcattaaataaggatttacatgtcttagcacttagaaatccatatgat
ttatattacacaaaaaatattaaaaactatgttgccttttatgagtacacaccaaactca
atcgaagcagttgttaaatacttaaaaggtcaattaaaaccacaaggagtttcaccgata
cgttatgaataa

DBGET integrated database retrieval system