KEGG   Acholeplasma laidlawii: ACL_0304Help
Entry
ACL_0304          CDS       T00659                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
acl  Acholeplasma laidlawii
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:acl00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
313992..314609
Genome map
AA seq 205 aa AA seqDB search
MKLNDRGLLIVISGPSGVGKGTVRKALFDMKNHNLEYSVSVTTRAPRVGEVDGKDYYFVN
RAAFEEMIRQDRFLEYAEFVGSYYGTPKDKVEEMLDKGKEVVLEIEVDGALQVRERMKDA
VFIFLVPPSKKALYERLSRRGTDTPEIVNKRFQKAESEFKLAYKYDYIVVNDDVNNAADR
IMAIIRAEHARTQRTIQKYQQLMEE
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaaatgatcgtggattactcatcgtcatatccggaccatctggagttggaaaa
ggtacagtgcgtaaagcgctttttgacatgaagaaccataacctagaatattctgtatca
gttacaacaagagcacctagagtcggcgaagttgatggcaaagactattattttgtaaat
cgtgcagccttcgaagaaatgattcgccaagacagatttttagagtatgcagagtttgtg
ggtagctattatggcacaccaaaagacaaagttgaagaaatgcttgataaaggtaaagaa
gttgtattagaaattgaagtggatggtgcacttcaagtacgtgaacgtatgaaagatgct
gtctttatatttttagtgccaccaagcaaaaaagccttatatgagcgtttaagcagacgt
ggaacggatacacctgaaattgtaaataagagatttcaaaaagctgaaagtgaatttaaa
ttagcatataaatatgattatatcgtagtaaatgatgatgtaaataatgctgcagatcgt
attatggcgatcattcgtgcagaacatgcacgtactcaaagaactattcaaaaatatcaa
cagttaatggaggaataa

DBGET integrated database retrieval system