KEGG   Acholeplasma laidlawii: ACL_0351Help
Entry
ACL_0351          CDS       T00659                                 

Definition
bifunctional formamidopyrimidine-DNA glycosylase/dephospho-CoA kinase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
acl  Acholeplasma laidlawii
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:acl03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
368412..369770
Genome map
AA seq 452 aa AA seqDB search
MPELPEVETIRRNLNTVLEGEIIREVLVYYRPIVSNDASFETKLKGQRIHKVEREAKYLK
FILDDYLLVSHLRMEGKYFMDAPLNKHIHVVFNLSSGHTLSYEDTRKFGRFELVDIKYKD
TYLKDIKGLAKDPDTLDLNTFYSSFNQRSKTIKEILLDQSIIGGIGNIYANEILYLSKIH
PAKKGFLISKDEAKTLLNNSNLVLNKAIEMGGTTIDTFESLGHKGEFQQELNVHGKTGEI
CKVCGTKIIKFQLKGRGTYICPKCQPSYVVAITGGIATGKSTATNYLRKKGFVVVDSDEI
VGSLYQDSDVLNLIAKTFKMETPIDKAKLANIVFHDEKQRKKLEHILHPLVFDEISKQKQ
LNNEHILFLDIPLLFESNYKEFDESILIDTTEALQLDRLMKRNKYTQEEALVRIKAQIPL
SKKRKLATHIIKNNGSIDALYEKIDKLLERYV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaactacctgaggtagaaaccattcgtagaaatttaaatacagtattagaaggt
gaaatcatacgtgaggttttagtatactatcgacctattgtttcaaatgatgcgtcattt
gaaaccaaattaaaaggtcaacgtatacataaagtagaacgtgaagcaaagtatttaaag
tttattttagatgactatcttttagtatctcatttacgtatggaaggcaaatactttatg
gacgcgcctttaaataaacatatacatgtagtgtttaatctatcaagcggtcacacgtta
agttatgaagatacacgtaaatttggccgttttgaactggtagatattaaatataaagac
acttatttaaaagatattaaagggcttgctaaagaccctgataccctagatttaaacacc
ttttatagtagttttaatcaaagaagtaaaacgattaaagaaatattactggatcaatcc
attattggtggtattggtaatatttatgcaaatgaaatactttacttatctaaaatacat
ccagccaaaaaaggttttttaatcagtaaagatgaagcaaaaaccttactaaataactct
aatcttgttttaaacaaggccatcgaaatgggtggaacgacaattgacacctttgaatca
ttagggcataagggtgagtttcaacaggagttaaatgttcatggcaaaactggagagatt
tgtaaggtatgtggcactaaaataattaaatttcagttaaaaggacgaggtacttatatt
tgtcctaaatgccaaccatcttatgtagtcgcaatcacaggtggtattgcaaccggtaaa
tctactgcaacaaactatttaagaaaaaaaggatttgtagttgtagattctgatgaaatt
gtaggaagtctttatcaagatagtgatgtactaaatttaattgcaaaaacctttaaaatg
gaaacaccaattgataaagcaaaacttgcaaacatcgttttccatgatgaaaaacaaaga
aaaaaattagaacacatcttacatccactcgtttttgatgaaattagcaaacaaaaacaa
ttaaataatgaacatatcttatttttagatattcctttattatttgaatcgaattacaaa
gagtttgatgaatccatcttaatagatacaactgaagcacttcaactggatagattaatg
aagcgcaacaaatatactcaagaagaagcacttgttcgtataaaagcgcagataccttta
agtaaaaagcgcaaactagctacacacattataaaaaataatggatctatagatgcgtta
tatgaaaaaatagataaattattagaaaggtatgtataa

DBGET integrated database retrieval system