KEGG   Acholeplasma laidlawii: ACL_0529Help
Entry
ACL_0529          CDS       T00659                                 

Gene name
glgB
Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
acl  Acholeplasma laidlawii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACL_0529 (glgB)
Enzymes [BR:acl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     ACL_0529 (glgB)
Exosome [BR:acl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACL_0529 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
561317..563179
Genome map
AA seq 620 aa AA seqDB search
MGRYIKLAFTESHANLYLLGKNYLAHQFLGAHLNKDDDGNIISTTFTVYAPNAKEVRLIA
DFNNYEGWKHVLTKIHPQGFWSITIPKDLEWATYKYEIHLKNGKISHKSDPFGYFSEVRP
SNASKVYDIDGYHWKDHDWFKNKKKVYDQPMLIYEVHLGSWQRNNGQFRPYNEVVKDLID
HVKYNGFTHIELMPVYEHPLDDSWGYQGTGFFAATSRFGSPKDLMYLIDQCHQHGIGIIM
DWVLGHINKDDFGLFNFDGTYLYEYEDTFKRENITWGTANLDFNKGITKSFMMSALTFWM
DYFHVDGFRIDAVSHLFYYLGDESNGINEEAIAFLKEISAHVFSKDETFILSAEDSTAFP
LVTKPTFLGGIGFNYKWNMGFMNDVLSYFKLDPIYRKHNHDKLTFGLVYAFNEQFILPFS
HDEVVHLKGSLVSKMPGSYEQKFAHYRNLMTFYMTHPGKKLLFMGQEFAQIAEWDFKKEL
DWNLLKFPIHDAFNRYFRDLAHVYKHHDALYQKDHDPSGFKWLIVDHKDTSVFAYARYSD
NEVLVMVHNLTPNYYQSYEVGVPFEGTYEEILNSNKDIYNGTNLYNGLPLKTYKEPRNGQ
PYHLKVQLSGLTSIIFKYKK
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
ttggggaggtacataaaattggcatttacagaatctcatgcaaatttatatctattaggc
aagaactatttagcacatcagtttttaggtgcacacctgaataaggatgatgatggcaac
atcatatctactacatttactgtttatgcacccaacgcaaaagaagttagacttattgca
gatttcaacaattacgaaggctggaagcatgttctaactaaaattcatccacaaggattt
tggtccattacaatacccaaagaccttgaatgggcaacttataaatatgagattcatcta
aagaatggaaagatctcacataaatcagatccgtttggatacttttctgaagtaagacca
tcaaacgcatctaaagtttatgatattgatgggtatcattggaaggatcatgactggttt
aaaaacaagaaaaaagtctatgatcaaccaatgcttatctatgaagtgcatcttggctct
tggcaaagaaataatggtcaatttagaccgtataatgaagtggttaaagatttaattgac
catgtaaaatacaacggatttacccatattgaactcatgccagtctatgaacatccactg
gatgactcatgggggtatcaaggtactggtttttttgcggcaacttctagatttgggtca
ccaaaagatttaatgtatttaatcgatcagtgtcatcaacatggtattggtatcatcatg
gactgggttttaggacatattaataaagatgactttggtttatttaattttgatggcact
tatctttatgaatatgaggatacctttaaaagagaaaacataacatggggtactgcgaat
ctagacttcaataaaggtattactaaaagttttatgatgtctgcccttactttttggatg
gattacttccatgttgatggatttagaattgatgctgtatctcacctgttttattatcta
ggtgatgagtccaatggtatcaatgaagaagctattgcatttttaaaagaaatttcagca
catgtatttagtaaggatgaaaccttcatcctatctgcagaagactcaacggcatttcca
ctcgttaccaaaccaacctttcttggtggtattgggttcaactataaatggaatatgggc
tttatgaatgatgtcttatcttactttaaacttgatccgatatacaggaaacataaccat
gataaactaacttttggcttagtttacgcatttaatgaacaatttattttaccctttagc
catgatgaggtcgtacacctaaaaggttccttagtcagtaaaatgccgggaagttatgaa
caaaagtttgcgcattatagaaaccttatgacattctatatgacacacccgggtaaaaag
ttactatttatgggtcaggaatttgcacaaattgctgaatgggattttaaaaaggaactt
gactggaacttattaaagtttccgatacatgacgcttttaatagatactttagggattta
gcacatgtgtataaacaccatgatgcactttatcaaaaagatcatgatccgtcaggattt
aaatggttaatcgtggatcataaagacacatctgtctttgcttatgcaagatactcggat
aacgaagtacttgtcatggttcataatctaactccaaactattatcaaagctatgaagtt
ggtgtaccttttgaaggaacatatgaggaaatattaaattccaacaaagacatttataat
ggaacaaacttatacaacggcttaccacttaaaacctacaaagaaccaagaaatggtcaa
ccatatcatctcaaggtacaactttcagggttaacgagtattatctttaaatataaaaaa
tga

DBGET integrated database retrieval system