KEGG   Acholeplasma laidlawii: ACL_0560Help
Entry
ACL_0560          CDS       T00659                                 

Gene name
recD
Definition
ATP-dependent exoDNAse (exonuclease V) subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
acl  Acholeplasma laidlawii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:acl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ACL_0560 (recD)
Enzymes [BR:acl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ACL_0560 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
596354..598603
Genome map
AA seq 749 aa AA seqDB search
MEIKVRGFIKSYVFKNESNGYTIAKLETNDKELISIVGYFPLLSEELEYEFTGEETIHPK
FGRQLTVKSYERLENTSESGLVRYLSSDNFSGIGPVTAEKIVSLLGTDAIEKIITDENVL
SPILNPIKRNRLKKELISHQAEQRIFVKLLDLGLTTRISAKLFSNYGSQTLEKLEEDPYR
LMYEIDGFGFIKSRDIAEKFGISKTDIRTLKAALVYALITTSNSEGNLYLFEEELMSRVS
RVIDVDADFKPAIDELIKENKLVLEDDKYFLKQIYRDEIDIAKRIKELKTYPLDHVDTEL
LELMLSQISIQKSIDYTEKQRQAIITAMQNPLTVITGGPGTGKTTLIDGFLELYAKYFKI
NLKSKDATNEIALMAPTGRASKRMRELLDFPARTIHSHLGFDFDQSFKSNKVQPLVQNLI
IIDEASMIDIYLMKRLLNSIIDGTRVVIVGDEDQLPSVGPGYVLGDLISSNVVPVIRLNE
IHRQAKDSHIVKLASSINNQNLSQEDLISHNDVTFYSGTGEDIKRVIINQIGGAMKKGYD
LINDIQVLIPQYKGDLGIDTMNLEIQAKFNPNYNQPPFMKFGDKTYYIGDKVIQLQNDKD
KEIMNGDIGVVKAIRKNDKNQKILQVDFDGLLVNYDQNELDTLNLAYVISIHKSQGSEYQ
VVFLPIIKSYLHMLKKELIYTAITRAKSHLLVLGDLRLLQYASNQLVEKRHTMLKERLTH
DEVSFNLFDQLSEEDDLDETKDLSPWDFM
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaagtaagaggattcatcaaatcctatgtttttaaaaatgaatctaatggc
tatacgattgctaaactagaaaccaatgataaagagttaatctctattgttggttatttt
cctttattaagtgaagaattagaatacgagtttactggtgaagagaccatacaccctaaa
tttgggcgtcaactgacagttaaaagttatgaaagattagaaaacacttcagaatcaggt
ttagtcagatacttatccagtgataatttttctggtattggaccggttacagctgaaaaa
atagtcagtttattaggcacagatgccatagaaaaaataatcactgatgaaaatgtatta
agtccaattttaaatccaatcaagcgaaatagactcaaaaaagaattaattagtcaccaa
gctgaacaacgtatttttgttaaacttttagatttaggtctaactacccgtatatctgct
aaattgtttagcaattatggcagtcaaaccttagaaaagttagaagaagatccttatcga
ctgatgtatgaaattgatggatttgggtttataaaatcaagagatatcgctgaaaaattt
ggtatttcaaaaacggatattagaactttaaaagctgcattagtttatgcactcataact
acatctaatagtgagggtaacctctacttatttgaagaagaactgatgagtagagtatct
agagtcattgatgtagatgctgattttaaaccagcgattgatgaactcattaaagaaaat
aaattagtattagaagatgataagtacttcttaaaacaaatctatagagatgaaattgat
attgcaaaacgcattaaagagttaaaaacatatccacttgatcatgtggatactgaacta
ttagagttgatgttatctcagatctctatacaaaaatctattgattatacagaaaaacaa
agacaagctattattacagcaatgcaaaatccactcactgttattactggtggaccaggt
actggtaaaacgaccttaattgatgggttcttagagttatatgctaaatattttaaaatt
aacttaaaatctaaagatgcaaccaatgagattgcacttatggcaccaacaggacgtgca
tctaaacgtatgagagaattacttgattttcctgcacgtacgattcactcacatttagga
tttgattttgatcagtcatttaagtccaataaagttcaaccactggttcaaaatcttatt
atcatcgatgaagcatcgatgatagatatctacttaatgaaaagactcctaaatagcatt
atagatggtactagagtcgttattgtgggtgatgaagatcaactaccaagtgttggtccg
ggctacgttttaggtgatttaattagttctaatgttgtaccagtgataagacttaatgaa
atacatagacaagctaaggattctcatattgtaaaactagcatcctctattaataatcaa
aatttaagtcaagaagatttaattagtcataatgacgtgaccttttatagtggtactggt
gaagatattaaaagagtaatcattaatcaaattggtggcgccatgaaaaaaggctatgat
ttaattaatgacattcaagttttaatacctcaatataaaggtgacttaggtattgataca
atgaacttagaaatacaagctaagtttaatccaaattataatcaaccaccatttatgaag
tttggcgataaaacctactacataggtgataaagtcatccaacttcaaaatgataaagac
aaagaaatcatgaatggtgatattggtgtagttaaagcgatacgtaaaaacgataaaaat
caaaagattttacaagtagattttgatggtttattagtgaattacgatcaaaatgaacta
gataccttaaacctcgcttatgtcatttcaattcataagtcacaaggttcagaatatcaa
gtagttttcctaccgattattaaaagttatttacatatgctaaaaaaagaacttatatat
accgcgattacacgtgcaaaatcacatctattagtattaggagatttaagattacttcaa
tacgcatcgaatcagttagttgaaaaaagacatacgatgcttaaagaacgacttacacat
gatgaagtatcattcaacttatttgatcaattaagtgaagaagatgatttagatgaaact
aaagatttaagtccatgggactttatgtag

DBGET integrated database retrieval system