KEGG   Acholeplasma laidlawii: ACL_0692Help
Entry
ACL_0692          CDS       T00659                                 

Gene name
argE
Definition
dipeptidase PepV (EC:3.5.1.16)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
acl  Acholeplasma laidlawii
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:acl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ACL_0692 (argE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    ACL_0692 (argE)
Enzymes [BR:acl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     ACL_0692 (argE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(724705..726081)
Genome map
AA seq 458 aa AA seqDB search
MSIDFKALALKYKDQFIKDTQELLRINSELTTFDPNRVGAPFGEGNKQALEFMLNLAKRD
GFKFENVDGYAGHIEYGDSKEYIGSIGHLDVVPAGTGWTYPAYGAEIHDNKIYARGAEDD
KAPTMAVYYGMKILKELGVELKTRIKLILGLDEESGWKCVDYYFNKYPQAPIAGFIPDAD
FPLIYAEKGITMTIIRGQFNNDILYKVEGGLRANMVPESAKAHVKPDLVIKHRFLDYLEK
NNFKGQAKLENDVLVLETFGKSAHGSLPDDGVNALHILFEALKFAGVENELVNFATKYLT
FDNLGKKLGVAYKDKEMGDLTVNFGLASTDNNQFELVLNLRYPNGVNYDKDVFEKIANLL
PEGFGLDVDHHQKLLYKDPNSTLIKTLMKVYQKHTNDMTPPISIGGGTFARATENVVAFG
PHFIDKPTYIHQKDEFIDIDDLMKALAIYTESLYELAK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatagattttaaagcattggccctaaaatataaggaccaatttattaaagatact
caagagttgttaagaattaattctgagttaacaacttttgatccaaatagagtgggtgca
ccatttggagaaggcaataagcaagcattggagtttatgcttaatttagctaaacgtgat
ggtttcaagtttgaaaacgttgatggttatgcaggacacattgaatatggtgattccaaa
gaatatattggttccattggtcacttagacgttgtcccagcaggtactggttggacttat
ccagcttatggtgccgaaatccatgataataagatttatgcacgtggtgctgaagatgat
aaagcacctacaatggctgtttattatggtatgaagatattaaaagaattaggtgtagaa
cttaaaacacgtattaaactgattttaggacttgatgaagaatcaggttggaaatgtgtt
gattactactttaataagtatccacaagctccaattgcaggttttatcccagatgcagat
tttcctttaatctatgctgaaaaaggtattactatgaccattattagaggtcagttcaat
aatgacatcctatacaaagtagagggtggcttacgtgcaaatatggtaccagaaagtgct
aaagcgcatgtaaaacctgatttagtaattaaacatagatttttagattacctagaaaaa
aataacttcaaaggccaagctaaattagaaaatgatgtattagtacttgaaacatttggt
aaatcagcacatggatcgcttccagatgatggtgtgaatgcattacacattttatttgaa
gcactaaaatttgcaggtgttgaaaatgaattagtaaattttgctactaaatatttaaca
tttgataatttaggtaaaaaattaggtgttgcttataaagataaagaaatgggcgactta
acagtgaactttggtttagcaagtactgataacaaccaatttgaacttgtattaaactta
agataccctaatggcgtcaactatgataaagatgtatttgaaaagattgcaaatctatta
cctgaaggatttggtttagatgttgatcatcatcaaaaattattatacaaagacccaaat
tcaacattaattaaaacattaatgaaggtatatcaaaaacataccaatgacatgactcct
ccaatttcaattggtggcggtacatttgcaagagcaacagaaaatgttgtagcatttgga
ccacatttcattgataaacctacatatattcaccaaaaagatgagtttattgatattgat
gacttaatgaaagctctagcaatttatacagaaagtctttacgaactcgcaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system