KEGG   Acholeplasma laidlawii: ACL_0777Help
Entry
ACL_0777          CDS       T00659                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
acl  Acholeplasma laidlawii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:acl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ACL_0777 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACL_0777 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ACL_0777 (trpB)
Enzymes [BR:acl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ACL_0777 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(813255..814430)
Genome map
AA seq 391 aa AA seqDB search
MEFGQFGGAYLPPYLLTAIKEVEDAYNKFKDDPAFIEEFKDLLNTYAGRPSNLYFAKRLT
ECLGGAKVYLKREDLNHTGSHKINNVIGQALLAKRMGKKKLIAETGAGQHGVATATVAAL
LGLECEIHMGAVDVEKQALNVYKMQLLGATVVSVQEGLRTLKEAVDSALIKWSTEHESMF
YLIGSAVGPHPYPMMVRDFQKVIGIEIKEQILKLENRLPDYVIACVGGGSNAIGAFFDFI
PDPTVKLIGVEALGKGLDTNLHAATMTLGQTGVIHGMKTKVLLDDKGEISPVYSISAGLD
YPGVGPEHAYLDEIKRVTYFGATDEEAVQAFEYLTLIEGIIPAIESSHALAYAISLAKTL
PKDQIIVVNLSGRGDKDVKHIARFRGFEIVD
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggaatttggacaatttggtggggcatacttaccaccgtacttacttaccgcaattaaa
gaagtagaggatgcatataataaattcaaggatgatcctgcatttattgaagaatttaaa
gacttactcaatacatatgctggtagaccttctaatttgtattttgctaaacgcttaaca
gaatgtcttggtggtgcaaaagtatatttaaaacgtgaagacttaaatcatacaggttct
cacaaaattaataatgtcattgggcaagcgttacttgctaaacgtatgggtaaaaagaag
ttgattgcagaaacaggtgctggacaacatggtgtagccactgcaactgtagcagcacta
cttggtttagaatgtgaaattcatatgggtgcagtagatgttgaaaaacaagcacttaat
gtttataagatgcaacttttaggtgcaactgtagttagtgttcaagaaggattaagaaca
cttaaagaagctgttgatagtgctttaataaaatggagtactgaacatgaatcaatgttt
tacttaattggttcagcagttggaccacatccatatccgatgatggttcgtgatttccaa
aaagttattggtattgagattaaagaacaaatactaaaattagaaaatagactaccagat
tatgtcattgcttgtgttggtggcgggtctaatgcaattggtgcattctttgattttatt
ccggatcctactgtaaaacttattggcgttgaagcgttaggtaaaggtttagatacaaat
ttacatgctgctacgatgacacttggtcaaactggggttattcatggaatgaagactaaa
gttttattggatgataaaggtgaaatttcaccagtatactcgatttctgccggacttgac
taccctggtgttggtccagaacatgcatatttagatgaaattaaacgtgttacttacttt
ggtgcaacagatgaagaagctgtacaagcatttgagtatttaacacttatagaaggtatc
atacctgcaatagaatcctctcatgctctagcctatgcaatatcgcttgcaaaaacttta
ccaaaggatcagattattgttgttaacttatctggtcgtggcgataaagatgttaagcat
attgctaggtttagaggttttgaaatcgttgattga

DBGET integrated database retrieval system