KEGG   Acholeplasma laidlawii: ACL_0839Help
Entry
ACL_0839          CDS       T00659                                 

Gene name
galU
Definition
UDP glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
acl  Acholeplasma laidlawii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ACL_0839 (galU)
   00052 Galactose metabolism
    ACL_0839 (galU)
   00500 Starch and sucrose metabolism
    ACL_0839 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    ACL_0839 (galU)
Enzymes [BR:acl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ACL_0839 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(872493..873353)
Genome map
AA seq 286 aa AA seqDB search
MIKKAVVPAAGWGTRFLPITKAVPKEMLPIIDKPALSYIIEEAVASGIEEILIIISSNKG
AIQSYFEHNVELEQFLKEKNKLDDIKLIKNTSYGAKIFYTTQEEQLGLGHAVLQAEKFIN
GEPFAVLLGDDVYVSEEKPALLQLIDAYNDKKSSILGTMEVPLEDTKLYGICIPKKDSVK
PIVELEGVVEKPKSNPPSHSAISGRYVLTPKIFQLLKDQKRGAGNEIQLTDSILRLMDYE
KVFSFDMIGKRYDIGSKIGYIEAIIDFGLKRDDLKKDLNEILSKKI
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaagcagtagtacccgcagcaggctgggggacaaggtttttaccaataact
aaagcagttccaaaagaaatgctaccaattattgataaaccagcattaagttatattatt
gaagaggcggttgcatcaggtatagaagaaatattaattattatttcatccaataaaggg
gcaatacaatcttactttgaacataatgttgagttagaacaattcttaaaagaaaaaaat
aaacttgatgatattaaactcatcaaaaatacaagttatggtgcaaaaatattttacaca
acacaagaagaacaactaggtttaggtcatgcagtcttacaagcagaaaaattcattaat
ggtgaaccgtttgcagtgttacttggagatgatgtgtatgtatcagaagaaaaacctgca
cttttacaactaattgatgcttataatgataagaaatccagtattttaggtaccatggaa
gttccactagaagacaccaaattatatggtatttgtatacctaaaaaagatagtgtcaaa
ccaattgttgaactagaaggtgttgttgaaaaacctaaatcaaatccaccatcacactca
gcaatttctggtagatatgtacttactccaaaaatctttcaattactaaaagatcaaaaa
agaggtgctggtaatgagattcaattaaccgactccatcttaagattaatggactatgag
aaagtattttcatttgacatgattggtaaaagatatgatattggatcaaagattggttat
attgaagctatcattgattttggtttaaaacgcgatgacttgaaaaaggatttgaatgaa
atcttaagcaaaaagatttag

DBGET integrated database retrieval system