KEGG   Acholeplasma laidlawii: ACL_1091Help
Entry
ACL_1091          CDS       T00659                                 

Gene name
pfk1
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
acl  Acholeplasma laidlawii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:acl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACL_1091 (pfk1)
   01230 Biosynthesis of amino acids
    ACL_1091 (pfk1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACL_1091 (pfk1)
   00030 Pentose phosphate pathway
    ACL_1091 (pfk1)
   00051 Fructose and mannose metabolism
    ACL_1091 (pfk1)
   00052 Galactose metabolism
    ACL_1091 (pfk1)
  Energy metabolism
   00680 Methane metabolism
    ACL_1091 (pfk1)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ACL_1091 (pfk1)
Enzymes [BR:acl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ACL_1091 (pfk1)
Protein phosphatases and associated proteins [BR:acl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ACL_1091 (pfk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1127746..1128696)
Genome map
AA seq 316 aa AA seqDB search
MKIAVLTSGGDAPGMNAAIRAIVRTGIAEGHEMFGIMDGYRGLLEDRFIPLAAKDVSGML
SIGGTKLGTARVSEFKEVPVQMVAIDNLRNRGIDALIVIGGDGSYRGAQALHELEFQTIA
IPGTIDNDVYGTDYTIGFHTALNTIVEAIDKLRDTSSSHRRCSIIEVMGRTSGDLALYAG
ICGGAEFIITPENPINKDKLISTLKKHNEEGRRHAIIVVTEQQFDVHKLAAEISIKSGFS
SRATVLGYIQRGGTPIAEDRILASRMGAFAVEMLAKGVSGQCVGIKDDKLVTSPLSDIIN
HPKERVELYDLIKKLR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcagttttaacttctggcggcgatgcacctggaatgaacgcagcaattcgt
gcaattgtgcgtacaggtattgcagaaggtcatgagatgtttggtattatggatggttat
agaggtcttttagaagatcgttttataccgctagctgccaaagatgtttcaggtatgtta
agcattggtggtacaaaactgggtactgcaagagtatctgagtttaaagaagtaccagtt
caaatggtagcaatcgataatctacgtaatcgtggtattgatgctttaatcgttattggt
ggtgatggtagttacagaggtgctcaagcactccatgaactagaattccaaaccatagct
attcctggaacaattgataatgacgtttatggaacagattatacaatcggattccatact
gcattaaatacaattgtagaagcaatagataaactaagagatacatcatcgtcacataga
cgttgtagtattattgaagttatgggtagaacatcaggtgatttagcattatatgcaggt
atctgtggtggtgctgagttcattattacaccagaaaacccaattaataaagataagtta
atttcaacattaaaaaaacataatgaagaaggcagacgccatgccatcattgttgtcact
gaacaacaatttgatgtgcataaacttgctgctgaaatctcaatcaaatctggatttagt
tcacgagcaacagtacttggttatatccaaagaggtggaacaccaattgctgaagaccgt
atcttagcatcacgtatgggtgcatttgcagtcgaaatgcttgccaaaggtgtgagtgga
caatgtgttggtataaaagatgataaactagtaacatcaccattatctgatatcatcaac
catccaaaagaacgcgttgagctatatgatctcattaagaaattaagataa

DBGET integrated database retrieval system