KEGG   Acholeplasma laidlawii: ACL_1091Help
Entry
ACL_1091          CDS       T00659                                 

Gene name
pfk1
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
acl  Acholeplasma laidlawii
Pathway
acl00010  Glycolysis / Gluconeogenesis
acl00030  Pentose phosphate pathway
acl00051  Fructose and mannose metabolism
acl00052  Galactose metabolism
acl00680  Methane metabolism
acl01100  Metabolic pathways
acl01110  Biosynthesis of secondary metabolites
acl01120  Microbial metabolism in diverse environments
acl01130  Biosynthesis of antibiotics
acl01200  Carbon metabolism
acl01230  Biosynthesis of amino acids
acl03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:acl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACL_1091 (pfk1)
   00030 Pentose phosphate pathway
    ACL_1091 (pfk1)
   00051 Fructose and mannose metabolism
    ACL_1091 (pfk1)
   00052 Galactose metabolism
    ACL_1091 (pfk1)
  Energy metabolism
   00680 Methane metabolism
    ACL_1091 (pfk1)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ACL_1091 (pfk1)
Enzymes [BR:acl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ACL_1091 (pfk1)
Protein phosphatases and associated proteins [BR:acl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ACL_1091 (pfk1)
Messenger RNA biogenesis [BR:acl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ACL_1091 (pfk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ABX81701
UniProt: A9NH71
Position
complement(1127746..1128696)
Genome map
AA seq 316 aa AA seqDB search
MKIAVLTSGGDAPGMNAAIRAIVRTGIAEGHEMFGIMDGYRGLLEDRFIPLAAKDVSGML
SIGGTKLGTARVSEFKEVPVQMVAIDNLRNRGIDALIVIGGDGSYRGAQALHELEFQTIA
IPGTIDNDVYGTDYTIGFHTALNTIVEAIDKLRDTSSSHRRCSIIEVMGRTSGDLALYAG
ICGGAEFIITPENPINKDKLISTLKKHNEEGRRHAIIVVTEQQFDVHKLAAEISIKSGFS
SRATVLGYIQRGGTPIAEDRILASRMGAFAVEMLAKGVSGQCVGIKDDKLVTSPLSDIIN
HPKERVELYDLIKKLR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcagttttaacttctggcggcgatgcacctggaatgaacgcagcaattcgt
gcaattgtgcgtacaggtattgcagaaggtcatgagatgtttggtattatggatggttat
agaggtcttttagaagatcgttttataccgctagctgccaaagatgtttcaggtatgtta
agcattggtggtacaaaactgggtactgcaagagtatctgagtttaaagaagtaccagtt
caaatggtagcaatcgataatctacgtaatcgtggtattgatgctttaatcgttattggt
ggtgatggtagttacagaggtgctcaagcactccatgaactagaattccaaaccatagct
attcctggaacaattgataatgacgtttatggaacagattatacaatcggattccatact
gcattaaatacaattgtagaagcaatagataaactaagagatacatcatcgtcacataga
cgttgtagtattattgaagttatgggtagaacatcaggtgatttagcattatatgcaggt
atctgtggtggtgctgagttcattattacaccagaaaacccaattaataaagataagtta
atttcaacattaaaaaaacataatgaagaaggcagacgccatgccatcattgttgtcact
gaacaacaatttgatgtgcataaacttgctgctgaaatctcaatcaaatctggatttagt
tcacgagcaacagtacttggttatatccaaagaggtggaacaccaattgctgaagaccgt
atcttagcatcacgtatgggtgcatttgcagtcgaaatgcttgccaaaggtgtgagtgga
caatgtgttggtataaaagatgataaactagtaacatcaccattatctgatatcatcaac
catccaaaagaacgcgttgagctatatgatctcattaagaaattaagataa

DBGET integrated database retrieval system