KEGG   Acholeplasma laidlawii: ACL_1172Help
Entry
ACL_1172          CDS       T00659                                 

Definition
integral membrane protein
Orthology
K02124  
V/A-type H+-transporting ATPase subunit K
Organism
acl  Acholeplasma laidlawii
Pathway
Oxidative phosphorylation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acl00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    ACL_1172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1225157..1225609)
Genome map
AA seq 150 aa AA seqDB search
MEWILLSIIVLGVIFIALPLVKVFKGSVSALSAKKRIMLHIGLFATFFFTVAIIAPFAFA
AEFATPGVAESGFFYQAAAFGYLGAAISTGASALGAGIAVAAAAPAAIGAISENPKNLGK
SLIFVALGEGVAIYGMLISILILNTIPAIA
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggaatggattttattaagtatcatcgtgttaggggtaatctttatcgcattaccttta
gttaaagtttttaagggttcagtatcagctttatcagctaaaaaaagaattatgttacac
attggtttattcgcaacattcttctttacagtagcaatcattgcaccttttgcatttgca
gctgagtttgcaacgccaggtgtagctgaatcaggatttttctatcaagcagcagcattt
ggttatctaggtgcagcgatctcaactggtgcatcagcacttggtgcgggtattgccgtt
gcagcagcagcgccagcagcgattggtgctatttctgaaaatccaaaaaacttaggtaaa
tcattaatcttcgttgctttaggcgaaggggttgcgatttacggtatgttaatttctatc
ttgattttaaatacgattccagcaatcgcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system