KEGG   Acholeplasma laidlawii: ACL_1176Help
Entry
ACL_1176          CDS       T00659                                 

Gene name
gap
Definition
glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.59)
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
acl  Acholeplasma laidlawii
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:acl01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:acl01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:acl00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1229068..1230081)
Genome map
AA seq 337 aa AA seqDB search
MAIKVAINGFGRIGRLAFRLMVDNPAFDVVAINDLTDTETLAYLLKYDTAQGPFKGHEVS
TNGDKLVVDGKSITVYAQKDPSELPWGTLGVDVVLESTGLFTSAEKAGLHIKAGAKKVVV
SAPATGEGVKTVVYNVNDDILDGTETIVSAASCTTNALAPLAKVLDDNFGIVKGFMTTVH
AYTNDQSLMDQPHKKGFMSRRGRAAAASIIPSSTGAAAAIGLVLPQLKGKLDGTALRVPT
ITGSIVDLTVELGKEVTLAEIDAAFKAAANESLQYQPDPIVSADVIGSHFGSVYDANTTQ
ILKTDAKFVKVMGWYDNEMSYTAQLIRVMAKIANLTK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggctatcaaagtagcaattaacggatttggtcgtattggtagacttgcgtttcgttta
atggtagataacccagcatttgatgttgtggcaatcaacgatttaactgatacagaaact
cttgcttaccttttaaagtatgatacagctcaaggtcctttcaaaggtcatgaagtatca
acaaacggagataaattagtagttgatggtaaatcaatcactgtttacgctcaaaaagat
ccatctgagttaccatggggtacacttggtgttgacgtagtattagagtcaacaggatta
ttcacatcagctgaaaaagctggtttacacatcaaagcgggtgctaagaaagttgtagtt
tctgcaccagcaacaggtgaaggcgttaaaactgttgtttacaacgtaaacgatgacatc
ttagatggaactgaaacaatcgtttcagctgcatcatgtacaactaatgctttagctcct
ttagcaaaagttttagatgacaactttggtatcgttaaaggtttcatgactactgttcat
gcttacactaatgaccaatcattaatggatcaaccacacaaaaaaggtttcatgtcaaga
cgtggacgtgctgctgctgctagcattattccatcttcaacaggagctgctgctgcaatc
ggtttagtattacctcaattaaaaggtaaattagacggaacagctttacgtgtacctaca
attactggttcaatcgttgacttaacagttgaattaggtaaagaagtaacattagctgaa
attgatgctgctttcaaagctgctgctaacgaatcattacaatatcaaccagatccaatc
gtttctgctgacgtaattggttctcattttggatcagtttatgatgcaaacacaactcaa
atcttaaagacagatgctaaatttgttaaagttatgggttggtatgacaatgaaatgtca
tatactgctcaactaatcagagtaatggcaaaaatcgctaatttaactaagtaa

DBGET integrated database retrieval system