KEGG   Acholeplasma laidlawii: ACL_1206Help
Entry
ACL_1206          CDS       T00659                                 

Gene name
tpiA
Definition
triosephosphate isomerase (TIM) (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
acl  Acholeplasma laidlawii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:acl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACL_1206 (tpiA)
   01230 Biosynthesis of amino acids
    ACL_1206 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACL_1206 (tpiA)
   00051 Fructose and mannose metabolism
    ACL_1206 (tpiA)
   00562 Inositol phosphate metabolism
    ACL_1206 (tpiA)
Enzymes [BR:acl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ACL_1206 (tpiA)
Exosome [BR:acl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ACL_1206 (tpiA)
  Exosomal proteins of bladder cancer cells
   ACL_1206 (tpiA)
  Exosomal proteins of melanoma cells
   ACL_1206 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1256041..1256805)
Genome map
AA seq 254 aa AA seqDB search
MAKRIPVIAANWKMFKTKDEALEFIFAVNAAVPSRDEVESIICAPAILLNLLVKREGEHI
RIGAQNMHYADEGAFTGENSPAQVKTAGAEYILIGHSERRSLFNETDKDVNLKMHAAFKY
DLAPILCIGEQLDTREANKTKEVLDVQLDKAFEGVSKEQALKTIVAYEPVWAIGTGKTAT
PQMANDTIKDVRAKLSDLYGAEVAAQVRILYGGSVKPDNIESLLQESDIDGALIGGAALD
HKNFLTFTKAAKNK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaagaatacctgtaattgcagcaaactggaaaatgtttaaaactaaagatgag
gctttagaattcatttttgctgtaaatgctgcagtaccaagtagagacgaagttgagtct
attatttgtgcaccagcaatcttattaaacttattagtaaaacgtgaaggcgaacatatc
cgtattggtgcacaaaatatgcactatgctgatgaaggcgcatttactggagaaaactca
cctgcacaagtaaaaactgctggtgctgaatatatcttaattggacactcagaacgtcgt
agtttatttaatgaaacagacaaagacgtaaatttaaaaatgcatgctgcatttaaatat
gacttagctccaattttatgtatcggtgaacaattagatacaagagaagcaaataagact
aaagaagtattagatgttcaattagacaaagcattcgaaggtgtttctaaagaacaagca
ttaaaaacaattgtggcttatgaaccagtgtgggcaatcggaacaggtaaaactgctaca
ccacaaatggcaaacgatacaatcaaagatgtacgtgctaaactaagtgacctatatggt
gctgaagttgcagctcaagtacgtatcttatatggtggttctgttaaaccagataacatc
gaaagtctattacaagaatcagacatcgatggtgctttaatcggtggcgcagcattagat
cataaaaacttcttaacatttacaaaagcagcaaaaaacaaataa

DBGET integrated database retrieval system