KEGG   Acholeplasma laidlawii: ACL_1420Help
Entry
ACL_1420          CDS       T00659                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
acl  Acholeplasma laidlawii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:acl00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ACL_1420
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ACL_1420
Enzymes [BR:acl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ACL_1420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1483223..1483705)
Genome map
AA seq 160 aa AA seqDB search
MSIYQIRVEDMHNNIVTLDSYKGKVLLIVNTATTCFFTPQYDGLQKLYETYKNQGFEILD
FPSNQFKDAKDSVETIDEFCVKNYKTDFRRFTKIEVNGPDESILYTYLKRHQKGLFNKKI
KWNFTKFLVDQNGRVIKRYAPLVKPEKIAKDIEKLLNKDK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagtatctatcaaatacgcgttgaagatatgcacaataatattgttaccttagattca
tataaaggtaaagtgttattaattgttaacacagcaacaacttgttttttcacaccacag
tatgatgggctacaaaaattatatgaaacatataaaaatcaggggtttgaaatcttagat
ttcccaagtaatcaatttaaagatgctaaagatagtgtagaaacaattgatgagttttgt
gtgaaaaactataaaaccgattttagaagatttactaaaatagaggtgaatgggccagat
gagtctattttatacacctatttaaaaagacatcaaaaaggcttatttaataaaaaaatt
aagtggaactttactaagtttttagtagaccaaaatggccgcgttatcaaacgttatgca
ccacttgtaaaaccagaaaaaatagcaaaagacattgaaaaactattaaataaagataaa
taa

DBGET integrated database retrieval system