KEGG   Granulicella tundricola: AciX9_0024Help
Entry
AciX9_0024        CDS       T01411                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
acm  Granulicella tundricola
Pathway
acm00020  Citrate cycle (TCA cycle)
acm00310  Lysine degradation
acm01100  Metabolic pathways
acm01110  Biosynthesis of secondary metabolites
acm01120  Microbial metabolism in diverse environments
acm01130  Biosynthesis of antibiotics
acm01200  Carbon metabolism
Module
acm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AciX9_0024
  Amino acid metabolism
   00310 Lysine degradation
    AciX9_0024
Enzymes [BR:acm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AciX9_0024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: ADW67115
UniProt: E8X455
Position
27498..29135
Genome map
AA seq 545 aa AA seqDB search
MPTEVVMPQMGESITEGTLTKWLKKPGDPVERNEPLFEISTDKVDAEIPSPAAGIMGEIK
TPEGSTVQINTVVCTINEAGSAAAAAPAPADLKADSATPAAEATAAQEAAIPAPEPETEV
SGGTEVAMPQMGESITEGTITKWLKNIGDTVARDEPIFEISTDKVDAEIPSPVAGTLTEI
RVKEGATVTVNTIVAVIGGAAGSKPKAAAPAAVAPAAPAAVAAAPTQASQGETPRSSPLV
RKIAGDNNIDLQQVSGSGSAGRITKADIMGHLDKPASTAAATPTTVQPSVSAVQSAPATT
APAKAAAPTQQLGELVPMTKMRSIIAKRMVESKQTSPHVHTVFKVDMTRIVKLREREKNK
YEQRNGTKLTYMPFITRAAVQALKKHPVVNAAIQGDAIFYNKNIAIGIAVALEWGLIVPV
IKGCEEKNFLGVARSIVDLAERARTKKLAPDEVSGGTFTITNAGIFGEQFGTPIINQPQA
AILGVGGLNKEALVLTDKDGQDTIAIRNVQRFTLGFDHRIVDGADAGKFMSDFKAYLENW
AEDIG
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccgaagtagtcatgccccagatgggcgaatccattaccgaaggcacgctcacg
aaatggctcaagaagccgggcgaccccgtcgagcgtaacgagccgttgttcgagatctcg
accgacaaggttgacgctgagattccttcgcccgccgcgggcatcatgggtgagatcaag
acgcccgagggctcgaccgtacagatcaacacggttgtctgcacgatcaatgaggctggc
tctgctgctgccgccgcacccgcaccggctgacttgaaggctgactctgccactcccgct
gccgaagcgaccgccgcccaggaggctgcgattcctgctccagagcccgaaactgaagtc
agcggcggtaccgaagtcgccatgccgcagatgggcgagtccatcaccgaaggcacgatc
accaagtggctcaagaatattggcgataccgtcgcgcgtgacgagccgatctttgagatt
tcgacggataaggttgacgctgagattccgtcgcccgtcgccggcacgttgactgagatc
cgggtcaaggaaggcgctaccgtcaccgtcaacaccatcgttgcggtgatcggcggagcg
gcgggcagcaagcccaaggctgccgcgcctgccgccgttgccccagcggcacccgctgct
gttgctgccgcacccacgcaggcttcgcagggcgagacgcctcgctcctcgccgctggtc
cgcaagattgcgggtgataacaacatcgatctgcagcaggtctccggaagcggttccgcc
gggcgcatcaccaaggccgacatcatgggccatctggacaagcctgcctcgaccgctgct
gctactccgacgacggtgcagccttcagtctcggccgtgcagtctgcgcctgcgacgacc
gctccggccaaggccgcggcacccacgcagcagttgggcgagctggttccgatgaccaag
atgcgctccatcattgccaagcgcatggtggaatccaagcagaccagcccgcacgttcac
accgtcttcaaggtggacatgacgcgcatcgtcaagctgcgtgagcgcgagaagaacaag
tacgagcagcgcaacggcaccaagctgacctacatgccgttcatcacgcgcgcggctgtg
caggctctgaagaagcaccccgtggtcaacgccgccatccagggcgatgccattttctac
aacaagaacatcgccatcggaatcgcggttgcgctggagtggggcctgatcgtcccggtc
atcaagggctgcgaggagaagaacttcctgggcgtggcacggtcgatcgttgacctggcc
gagcgtgcgcggaccaagaagcttgctccggacgaagtctccggcggcacctttacgatc
accaacgcggggatcttcggcgagcagttcggcacgccgatcatcaaccagccccaggcg
gccatcctcggcgtcggcggcctgaacaaggaagccctggtgctgacggataaggatggg
caggacaccatcgccatccgcaacgtgcagcgcttcacgctgggcttcgatcaccgcatc
gtggacggcgcggacgcaggcaagttcatgagcgacttcaaggcgtatctcgagaactgg
gctgaagacatcggctaa

DBGET integrated database retrieval system