KEGG   Granulicella tundricola: AciX9_0024Help
Entry
AciX9_0024        CDS       T01411                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
acm  Granulicella tundricola
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:acm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AciX9_0024
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AciX9_0024
  Amino acid metabolism
   00310 Lysine degradation
    AciX9_0024
Enzymes [BR:acm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AciX9_0024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
27498..29135
Genome map
AA seq 545 aa AA seqDB search
MPTEVVMPQMGESITEGTLTKWLKKPGDPVERNEPLFEISTDKVDAEIPSPAAGIMGEIK
TPEGSTVQINTVVCTINEAGSAAAAAPAPADLKADSATPAAEATAAQEAAIPAPEPETEV
SGGTEVAMPQMGESITEGTITKWLKNIGDTVARDEPIFEISTDKVDAEIPSPVAGTLTEI
RVKEGATVTVNTIVAVIGGAAGSKPKAAAPAAVAPAAPAAVAAAPTQASQGETPRSSPLV
RKIAGDNNIDLQQVSGSGSAGRITKADIMGHLDKPASTAAATPTTVQPSVSAVQSAPATT
APAKAAAPTQQLGELVPMTKMRSIIAKRMVESKQTSPHVHTVFKVDMTRIVKLREREKNK
YEQRNGTKLTYMPFITRAAVQALKKHPVVNAAIQGDAIFYNKNIAIGIAVALEWGLIVPV
IKGCEEKNFLGVARSIVDLAERARTKKLAPDEVSGGTFTITNAGIFGEQFGTPIINQPQA
AILGVGGLNKEALVLTDKDGQDTIAIRNVQRFTLGFDHRIVDGADAGKFMSDFKAYLENW
AEDIG
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccgaagtagtcatgccccagatgggcgaatccattaccgaaggcacgctcacg
aaatggctcaagaagccgggcgaccccgtcgagcgtaacgagccgttgttcgagatctcg
accgacaaggttgacgctgagattccttcgcccgccgcgggcatcatgggtgagatcaag
acgcccgagggctcgaccgtacagatcaacacggttgtctgcacgatcaatgaggctggc
tctgctgctgccgccgcacccgcaccggctgacttgaaggctgactctgccactcccgct
gccgaagcgaccgccgcccaggaggctgcgattcctgctccagagcccgaaactgaagtc
agcggcggtaccgaagtcgccatgccgcagatgggcgagtccatcaccgaaggcacgatc
accaagtggctcaagaatattggcgataccgtcgcgcgtgacgagccgatctttgagatt
tcgacggataaggttgacgctgagattccgtcgcccgtcgccggcacgttgactgagatc
cgggtcaaggaaggcgctaccgtcaccgtcaacaccatcgttgcggtgatcggcggagcg
gcgggcagcaagcccaaggctgccgcgcctgccgccgttgccccagcggcacccgctgct
gttgctgccgcacccacgcaggcttcgcagggcgagacgcctcgctcctcgccgctggtc
cgcaagattgcgggtgataacaacatcgatctgcagcaggtctccggaagcggttccgcc
gggcgcatcaccaaggccgacatcatgggccatctggacaagcctgcctcgaccgctgct
gctactccgacgacggtgcagccttcagtctcggccgtgcagtctgcgcctgcgacgacc
gctccggccaaggccgcggcacccacgcagcagttgggcgagctggttccgatgaccaag
atgcgctccatcattgccaagcgcatggtggaatccaagcagaccagcccgcacgttcac
accgtcttcaaggtggacatgacgcgcatcgtcaagctgcgtgagcgcgagaagaacaag
tacgagcagcgcaacggcaccaagctgacctacatgccgttcatcacgcgcgcggctgtg
caggctctgaagaagcaccccgtggtcaacgccgccatccagggcgatgccattttctac
aacaagaacatcgccatcggaatcgcggttgcgctggagtggggcctgatcgtcccggtc
atcaagggctgcgaggagaagaacttcctgggcgtggcacggtcgatcgttgacctggcc
gagcgtgcgcggaccaagaagcttgctccggacgaagtctccggcggcacctttacgatc
accaacgcggggatcttcggcgagcagttcggcacgccgatcatcaaccagccccaggcg
gccatcctcggcgtcggcggcctgaacaaggaagccctggtgctgacggataaggatggg
caggacaccatcgccatccgcaacgtgcagcgcttcacgctgggcttcgatcaccgcatc
gtggacggcgcggacgcaggcaagttcatgagcgacttcaaggcgtatctcgagaactgg
gctgaagacatcggctaa

DBGET integrated database retrieval system